DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and SLC35C1

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_060859.4 Gene:SLC35C1 HGNCID:20197 Length:364 Species:Homo sapiens

Alignment Length:316 Identity:164/317 (52%)
Similarity:226/317 (71%) Gaps:1/317 (0%)


  Fly    16 LKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFT 80
            |:|..||||||.|||..||:||:||.|.::.|..|:|::::||:|:|::|...|.|:...|....
Human    39 LQIALVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVD 103

  Fly    81 FPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTS 145
            ||... ||:...|.:|||||::..||..|||.|.||.||||.:||||||||:|:|:|::|:|.||
Human   104 FPSLR-LDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTS 167

  Fly   146 FKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSY 210
            |..||.||.|:.|||||||||......||.||:||||:||.:::.:|.|.|.|..|:..:|.|::
Human   168 FYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTF 232

  Fly   211 YNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHN 275
            |||:.:.:|||||:::.|||:::..:..|.::.||..|||.||.|||||:||.|:||.||.||||
Human   233 YNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHN 297

  Fly   276 ISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQRS 331
            :|||||||||||:|..||.:.:|.||||||::||..|:|||.|:..||.:..::.|
Human   298 VSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPEEPS 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 137/265 (52%)
SLC35C1NP_060859.4 EamA 42..183 CDD:304911 73/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192082288
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 328 1.000 Inparanoid score I2430
Isobase 1 0.950 0 Normalized mean entropy S1961
OMA 1 1.010
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T1074161
orthoMCL 1 0.900 OOG5_129805
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1898
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.