DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and slc35c1

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005169110.1 Gene:slc35c1 ZFINID:ZDB-GENE-041212-11 Length:361 Species:Danio rerio

Alignment Length:309 Identity:163/310 (53%)
Similarity:218/310 (70%) Gaps:3/310 (1%)


  Fly    17 KIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTF 81
            ||..||:|||..||..||:|.:||  |:..|.||:|:::||||||..:|.:.|.||...|....|
Zfish    35 KIALVVTLYWFISISMVFLNNYLL--DSKELDAPVFITFFQCVVSVGLCLLMSFLSSLCPGSVDF 97

  Fly    82 PEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSF 146
            | ....|:...|:||||::::..||..|||.|.||.||||.:||||:|||:|:|:||:|:|.||.
Zfish    98 P-SLKFDLRVSREILPLTIVFISMITFNNLCLKYVGVAFYTVGRSLSTVFNVILSYVVLKQTTSL 161

  Fly   147 KCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSYY 211
            ..:||||.|:.|||||||||::....||.|.:|||::||.:::.:|.|||.|..|:..:|.||||
Zfish   162 YAVLCCGVILGGFWLGVDQEAVAGSLSWAGVVFGVIASLCVSLNAIFTKKVLPVVDGNIWKLSYY 226

  Fly   212 NNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNI 276
            |||.:.:|||||:||.||::|:..:..|....||..|||.|:.|||||:||.|:||.||.||||:
Zfish   227 NNLNAIVLFLPLLIILGEVKSVFEFSRLTDLHFWGMMTLGGVFGFAIGYVTGLQIKFTSPLTHNV 291

  Fly   277 SGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMR 325
            |||||:|||||:|..|:...:|.||||||::||..|.|||.||.:||.:
Zfish   292 SGTAKSCAQTVLAVVYWASEKSTLWWTSNLMVLGGSFAYTWVKGMEMKK 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 138/264 (52%)
slc35c1XP_005169110.1 tpt 42..335 CDD:129898 157/296 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192080912
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 319 1.000 Inparanoid score I2472
OMA 1 1.010
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T1053444
orthoMCL 1 0.900 OOG5_129805
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1898
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.