| Sequence 1: | NP_649782.1 | Gene: | nac / 40981 | FlyBaseID: | FBgn0265351 | Length: | 337 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001137962.1 | Gene: | frc / 39943 | FlyBaseID: | FBgn0042641 | Length: | 373 | Species: | Drosophila melanogaster | 
| Alignment Length: | 329 | Identity: | 88/329 - (26%) | 
|---|---|---|---|
| Similarity: | 138/329 - (41%) | Gaps: | 40/329 - (12%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     2 YKNLEEHNRLVNKYLKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICF 66 
  Fly    67 VASRLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLY--TLMI---GANNLSLSYVTVAFYYIGRS 126 
  Fly   127 LTTVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFS 191 
  Fly   192 IQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIIN---GELESIITYPHLWASWFWAAMTLSGL 253 
  Fly   254 CGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTS----NVVVLVASAA 314 
  Fly   315 YTRV 318  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| nac | NP_649782.1 | TPT | 16..281 | CDD:281186 | 73/272 (27%) | 
| frc | NP_001137962.1 | TPT | 67..348 | CDD:281186 | 82/308 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45464378 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11132 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||