DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and CG14971

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_647817.2 Gene:CG14971 FlyBaseID:FBgn0035449 Length:469 Species:Drosophila melanogaster

Alignment Length:355 Identity:79/356 (22%)
Similarity:140/356 (39%) Gaps:60/356 (17%)


  Fly     5 LEEHNRLVNKYLKIFFVVSLYWCTSILTVF----VNKHLLSSDTVNLGAPLFMSWFQCVVSTVIC 65
            |.:.|.::...:....::.||...||...|    :|:        .:..||.:..:..||..::.
  Fly    73 LAQENMMMQMAVGTLAIIFLYLALSISLTFYQTDINR--------QMPFPLAIVTYHLVVKFLLA 129

  Fly    66 FVASRLSRKYPSVFTFPEGNPLDID---TFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSL 127
            ..|.|:.|....      .:.:.:|   ..||:.|..|...:.||.:|..|:.|.::.|.:.:|.
  Fly   130 AAARRIYRMRVG------RSRVQLDWRLALRKMAPTGVASAIDIGFSNWGLALVPISLYTMTKSS 188

  Fly   128 TTVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGT----------IFGVL 182
            |.||.::.......::.|:..:...|.|..|..:          |:::.|          :|..|
  Fly   189 TIVFILLFAIAFGLEKKSWYLVSIVGLIGTGLLM----------FTYKSTDFNALGFFFILFASL 243

  Fly   183 SS---LALAMFSIQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLII-INGE-----LESIITYPH 238
            ||   .:.|.|.:| |..||..|....:  ||...:.....:||:| |.|.     :|.:..:..
  Fly   244 SSGLRWSFAQFIMQ-KSKLGLHNPIDMI--YYMQPWMIASLVPLVIGIEGAGLIAVIEDLHNHTS 305

  Fly   239 LWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWT 303
            ...:|..|.::...|..|.:.|...|.:..||:||.:|:|..|...|..:|.....|..|.:.:.
  Fly   306 NEITWAIARISAGALLAFLMEFSEFLVLCKTSSLTLSIAGIFKDICQLALAVTIRKDHLSVINYI 370

  Fly   304 SNVVVLVASAA-----YTRVKQLEMMRQHQ 328
            ..::.|.....     |:.:|  ||.||.:
  Fly   371 GLIICLAGIVCHLLHKYSNMK--EMQRQQE 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 65/291 (22%)
CG14971NP_647817.2 TPT 86..382 CDD:281186 71/323 (22%)
PMT_2 111..325 CDD:304453 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118227918
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11132
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.