DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and Slc35c1

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101218.1 Gene:Slc35c1 RGDID:1309463 Length:363 Species:Rattus norvegicus

Alignment Length:326 Identity:165/327 (50%)
Similarity:233/327 (71%) Gaps:1/327 (0%)


  Fly     7 EHNRLVNKYLKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRL 71
            |:...:.:.|:|..||||||.|||..||:||:||.|.::.|..|:|::::||:|::::|...|.|
  Rat    29 ENKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTL 93

  Fly    72 SRKYPSVFTFPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLT 136
            :...|.:..||..| ||:...|.:|||||::..||..|||.|.||.||||.:||||||||:|:|:
  Rat    94 ATCCPGMVDFPTLN-LDLKVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLS 157

  Fly   137 YVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYV 201
            |::|:|.|||..||.|..|:.|||||:|||......|..|||||||:||.:::.:|.|||.|..|
  Rat   158 YLLLKQTTSFYALLTCAIIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAV 222

  Fly   202 NQEVWLLSYYNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEI 266
            :..:|.|::|||:.:.:|||||:::.|||.:::.:.||.::.||..|||.||.|||||:||.|:|
  Rat   223 DHSIWRLTFYNNVNACVLFLPLMVVLGELHALLAFAHLNSAHFWVMMTLGGLFGFAIGYVTGLQI 287

  Fly   267 KVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQRS 331
            |.||.||||:|||||||||||:|..||.:::|.||||||::||..|:|||.|:..||.:..:..|
  Rat   288 KFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKTQEDPS 352

  Fly   332 T 332
            :
  Rat   353 S 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 137/265 (52%)
Slc35c1NP_001101218.1 TPT 38..302 CDD:281186 137/265 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192082766
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 332 1.000 Inparanoid score I2312
OMA 1 1.010
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T1087807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.