DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and Slc35c1

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_997597.1 Gene:Slc35c1 MGIID:2443301 Length:363 Species:Mus musculus

Alignment Length:317 Identity:165/318 (52%)
Similarity:229/318 (72%) Gaps:1/318 (0%)


  Fly    16 LKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFT 80
            |:|..||||||.|||..||:||:||.|.::.|..|:|::::||:|::::|...|.|:...|.:..
Mouse    38 LQIALVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVD 102

  Fly    81 FPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTS 145
            ||..| ||:...|.:|||||::..||..|||.|.||.|.||.:||||||||:|:|:|::|:|.||
Mouse   103 FPTLN-LDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTS 166

  Fly   146 FKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSY 210
            |..||.||.|:.|||||:|||......|..|||||||:||.:::.:|.|||.|..|:..:|.|::
Mouse   167 FYALLTCGVIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTF 231

  Fly   211 YNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHN 275
            |||:.:.:|||||:|:.|||.:::.:.||.::.||..|||.||.|||||:||.|:||.||.||||
Mouse   232 YNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHN 296

  Fly   276 ISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQRST 332
            :|||||||||||:|..||.:::|.||||||::||..|:|||.|:..||.:..:..|:
Mouse   297 VSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKTQEDPSS 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 138/265 (52%)
Slc35c1NP_997597.1 TPT 38..302 CDD:281186 138/265 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192081916
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 332 1.000 Inparanoid score I2403
Isobase 1 0.950 0 Normalized mean entropy S1961
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T1084259
orthoMCL 1 0.900 OOG5_129805
Panther 1 1.100 LDO PTHR11132
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1898
TreeFam 1 0.960
1312.830

Return to query results.
Submit another query.