DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nac and nstp-9

DIOPT Version :9

Sequence 1:NP_649782.1 Gene:nac / 40981 FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001361876.1 Gene:nstp-9 / 188685 WormBaseID:WBGene00011882 Length:317 Species:Caenorhabditis elegans


Alignment Length:314 Identity:138/314 - (43%)
Similarity:198/314 - (63%) Gaps:8/314 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTFP 82
            |.|.::.||..||..||:||||||.....|..|||::..||:|:..||.|....|.|...:.|| 
 Worm     6 IVFPIASYWVCSIGLVFINKHLLSGIGAELDIPLFITCCQCLVTIGICLVLRWGSFKTKYLKTF- 69

  Fly    83 EGNPLDI--DTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTS 145
              :.|||  :|...:||||:::..||..|||.|..|.|||||:|||:||||:|:||||.....::
 Worm    70 --SKLDINFETCIDVLPLSIVFVAMISFNNLCLRNVGVAFYYVGRSITTVFTVILTYVFFGDNST 132

  Fly   146 FKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSY 210
            ....:.|..|::||.:|.|||| .:..:..|.::|:.:|||:|:.::.||..|..|...:|.|::
 Worm   133 KGVNVSCLVILIGFGIGSDQES-QDPLTTSGVLYGMFASLAVALNALYTKSILPKVGNCIWQLTW 196

  Fly   211 YNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHN 275
            |||:.:.|||||||||||:...|..:...|:  ||..:.:||:.||.:.:||..:||.||.||||
 Worm   197 YNNILAVLLFLPLIIINGDFGKIWNHFPTWS--FWQLLFISGIFGFVMNYVTGWQIKATSPLTHN 259

  Fly   276 ISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQ 329
            ||.|||:.:|||||...|.:|:|.|||.||:::|:.|..||..|:.|:..:.:|
 Worm   260 ISATAKSASQTVIAVFLYSEVKSYLWWFSNLIILLGSMLYTIAKKSEVYSKLRQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 116/264 (44%)
nstp-9NP_001361876.1 TPT 13..299 CDD:331565 131/291 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160970
Domainoid 1 1.000 262 1.000 Domainoid score I1039
eggNOG 1 0.900 - - E1_KOG1442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54539
OrthoDB 1 1.010 - - D356503at33208
OrthoFinder 1 1.000 - - FOG0005416
OrthoInspector 1 1.000 - - otm14541
orthoMCL 1 0.900 - - OOG6_104078
Panther 1 1.100 - - O PTHR11132
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.