DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and nstp-9

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_509825.2 Gene:nstp-9 WormBaseID:WBGene00011882 Length:315 Species:Caenorhabditis elegans

Alignment Length:303 Identity:134/304 (44%)
Similarity:192/304 (63%) Gaps:8/304 (3%)


  Fly    29 SILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTFPEGNPLDI--DT 91
            ||..||:||||||.....|..|||::..||:|:..||.|....|.|...:.||   :.|||  :|
 Worm    15 SIGLVFINKHLLSGIGAELDIPLFITCCQCLVTIGICLVLRWGSFKTKYLKTF---SKLDINFET 76

  Fly    92 FRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSFKCLLCCGAIV 156
            ...:||||:::..||..|||.|..|.|||||:|||:||||:|:||||.....::....:.|..|:
 Worm    77 CIDVLPLSIVFVAMISFNNLCLRNVGVAFYYVGRSITTVFTVILTYVFFGDNSTKGVNVSCLVIL 141

  Fly   157 VGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLSYYNNLYSTLLFL 221
            :||.:|.|||| .:..:..|.::|:.:|||:|:.::.||..|..|...:|.|::|||:.:.||||
 Worm   142 IGFGIGSDQES-QDPLTTSGVLYGMFASLAVALNALYTKSILPKVGNCIWQLTWYNNILAVLLFL 205

  Fly   222 PLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNISGTAKACAQT 286
            |||||||:...|..:...|:  ||..:.:||:.||.:.:||..:||.||.||||||.|||:.:||
 Worm   206 PLIIINGDFGKIWNHFPTWS--FWQLLFISGIFGFVMNYVTGWQIKATSPLTHNISATAKSASQT 268

  Fly   287 VIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQ 329
            |||...|.:|:|.|||.||:::|:.|..||..|:.|:..:.:|
 Worm   269 VIAVFLYSEVKSYLWWFSNLIILLGSMLYTIAKKSEVYSKLRQ 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 113/254 (44%)
nstp-9NP_509825.2 TPT 15..297 CDD:281186 129/288 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192075353
eggNOG 1 0.900 E1_KOG1442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129805
Panther 1 1.100 O PTHR11132
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.