DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and nstp-10

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001263841.1 Gene:nstp-10 WormBaseID:WBGene00008237 Length:363 Species:Caenorhabditis elegans

Alignment Length:343 Identity:161/344 (47%)
Similarity:227/344 (66%) Gaps:17/344 (5%)


  Fly     6 EEHNRLV-------------NKYLKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQ 57
            ||:|:.:             ..|.::...||.||..||..||:||:||||  |.|.||||::|:|
 Worm     5 EENNKALFEAMRNRENPTKWESYKQVITAVSAYWVFSIGLVFLNKYLLSS--VQLDAPLFITWYQ 67

  Fly    58 CVVSTVICFVASRLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYY 122
            |:|:..:|...|:.|:.| .:|.|| ..|:|....|::|||||::..||..|||.|.||.|:|||
 Worm    68 CLVTVFLCLFLSKTSKAY-GLFKFP-SMPIDAKISREVLPLSVVFVAMISFNNLCLKYVGVSFYY 130

  Fly   123 IGRSLTTVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLAL 187
            :||||||||:||.||:||.|:||.:.:.||..|:.||.||||||.:|...|:.|.|||||:||::
 Worm   131 VGRSLTTVFNVVCTYLILGQKTSGQAIGCCALIIFGFLLGVDQEGVTGTLSYTGVIFGVLASLSV 195

  Fly   188 AMFSIQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSG 252
            |:.:|.|:|.|..|...:|.|:.||||.:.:|||||::.|||..::..:..|:.:.||..|||.|
 Worm   196 ALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGG 260

  Fly   253 LCGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTR 317
            :.||.:|:||..:|:.||.|||||||||||.||||:|..:|.::::.||||||.|||..|..||.
 Worm   261 VFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTY 325

  Fly   318 VKQLEMMRQHQQRSTATQ 335
            |::..|.:::...|.|::
 Worm   326 VQKRVMDKKNSGASPASE 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 133/265 (50%)
nstp-10NP_001263841.1 VRG4 31..325 CDD:227402 153/298 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192075328
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 308 1.000 Inparanoid score I1553
Isobase 1 0.950 0 Normalized mean entropy S1961
OMA 1 1.010
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T474145
orthoMCL 1 0.900 OOG5_129805
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1898
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.