DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nac and slc35c1

Sequence 1:NP_649782.1 Gene:nac FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_017948767.1 Gene:slc35c1 XenbaseID:XB-GENE-984504 Length:364 Species:Xenopus tropicalis

Alignment Length:327 Identity:161/328 (49%)
Similarity:224/328 (68%) Gaps:6/328 (2%)


  Fly    16 LKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPS-VF 79
            :||..||:|||..||..||:||:||.|.::.|.||||::::||||:.|:|...|.|:...|| :.
 Frog    36 VKIALVVTLYWFISITMVFLNKYLLDSPSLKLDAPLFVTFYQCVVTVVLCKGLSLLTHVVPSHIL 100

  Fly    80 TFPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRT 144
            .||... .|:...|.:||||:::..||..|||.|.|:.||||.:||.|:|||:|:|:|::|:|.|
 Frog   101 EFPSLR-FDLKVLRTVLPLSIVFIGMITFNNLCLKYLGVAFYTVGRCLSTVFNVLLSYIMLKQTT 164

  Fly   145 SFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFSIQTKKSLGYVNQEVWLLS 209
            |...|:.||.|:.|||||:|||......||.|..||||:||.:::.:|.|||.|..|:..:|.|:
 Frog   165 SMYALMSCGVILGGFWLGIDQEGAEGTLSWAGIFFGVLASLCVSLNAIYTKKVLPAVDGSIWRLT 229

  Fly   210 YYNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTH 274
            :|||:.:..||.||:.|.||:.::.|:..|:|..||..|||.|:.|||||:||.|:|:.||.|||
 Frog   230 FYNNVNACFLFTPLLFIFGEVGTLFTFDKLFAFSFWGMMTLGGIFGFAIGYVTGLQIQFTSPLTH 294

  Fly   275 NISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQ----HQQRSTATQ 335
            |||||||||||||:|..|||.::|.||||||::||..|.:||.||.|||.:.    :|.:|...:
 Frog   295 NISGTAKACAQTVLAVMYYHQIKSFLWWTSNLMVLGGSFSYTWVKGLEMKKSQGETNQSQSNGEK 359

  Fly   336 KA 337
            .:
 Frog   360 NS 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 131/266 (49%)
slc35c1XP_017948767.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192081865
eggNOG 1 0.900 E1_KOG1442
Hieranoid 1 1.000
Homologene 1 1.000 H41258
Inparanoid 1 1.050 317 1.000 Inparanoid score I2379
OMA 1 1.010
OrthoDB 1 1.010 D356503at33208
OrthoFinder 1 1.000 FOG0003807
OrthoInspector 1 1.000 T1060240
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1898
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.