DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Ascl3

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:62 Identity:28/62 - (45%)
Similarity:40/62 - (64%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 PVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            |...|||    |.|||:|::.:|:.:.|||::||....:::|||.|||:.|..|||.|..||
Mouse    91 PAFIRKR----NERERQRVKCVNEGYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 26/60 (43%)
Ascl3NP_064435.1 bHLH_TS_ASCL3 90..148 CDD:381588 26/60 (43%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 92..105 7/16 (44%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 106..144 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.