DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and ASCL2

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:88 Identity:31/88 - (35%)
Similarity:44/88 - (50%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 GSGKKRR--GKQITPVVKRKRRLAA------------NARERRRMQNLNQAFDRLRQYLPCLGND 288
            |...:||  ..::....:|:|...|            |.|||.|::.:|..|..|||::|..|..
Human    19 GCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGAS 83

  Fly   289 RQLSKHETLQMAQTYISALGDLL 311
            ::|||.|||:.|..||.||..||
Human    84 KKLSKVETLRSAVEYIRALQRLL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 26/72 (36%)
ASCL2NP_005161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..56 3/18 (17%)
bHLH_TS_ASCL2_Mash2 49..112 CDD:381586 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..177
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.