DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and bhlhe22

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_957249.2 Gene:bhlhe22 / 393930 ZFINID:ZDB-GENE-040426-1411 Length:261 Species:Danio rerio


Alignment Length:152 Identity:46/152 - (30%)
Similarity:62/152 - (40%) Gaps:50/152 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 TAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDED----LMLFSGGEDFDGNDGSFDLADGEN 231
            |:.||||..                   :.|.:||.|    :||               :.||..
Zfish    82 TSGAESSGG-------------------EQSPDDDSDERCEMML---------------MTDGRT 112

  Fly   232 QDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKH 294
            ....|...|.|:..:|      :..||..||||||||.:||.|.|.||..:|...:.  |:|||.
Zfish   113 TVPGAKSEGGKKNKEQ------KMLRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKI 171

  Fly   295 ETLQMAQTYI----SALGDLLR 312
            .||.:|:.||    .||.::.|
Zfish   172 ATLLLAKNYILMQAQALEEMRR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/64 (44%)
bhlhe22NP_957249.2 HLH 136..190 CDD:197674 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.