DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Olig3

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001099739.1 Gene:Olig3 / 293012 RGDID:1305997 Length:273 Species:Rattus norvegicus


Alignment Length:84 Identity:34/84 - (40%)
Similarity:49/84 - (58%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 AAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETL 297
            |||.|.|.:..||::....::.||..|.|||:||.:||.|.|.||:.:|.....  |:|||..||
  Rat    64 AAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATL 128

  Fly   298 QMAQTYI----SALGDLLR 312
            .:|:.||    |:|.::.|
  Rat   129 LLARNYILMLTSSLEEMKR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 26/66 (39%)
Olig3NP_001099739.1 bHLH_TS_OLIG3 70..150 CDD:381511 30/78 (38%)

Return to query results.
Submit another query.