DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurod4

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:118 Identity:43/118 - (36%)
Similarity:60/118 - (50%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVK------RKRRL 258
            ||:|::|:                      |.:|    |...||||.:...:.|      |.||:
  Rat    52 DSIEEEEE----------------------EEED----GDKPKRRGPKKKKMTKARLERFRARRV 90

  Fly   259 AANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .||||||.||..||.|.|.||:.:||....::|||.|||::|:.||.||.::|
  Rat    91 KANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 31/66 (47%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 39/111 (35%)
Neuro_bHLH 146..263 CDD:463621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.