DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Ascl2

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:109 Identity:37/109 - (33%)
Similarity:50/109 - (45%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LADG-------ENQDAAAGGSGKKRRGKQITPVV---KRKRRLAA-------------NARERRR 267
            |.||       ......||....:||..  :|.:   .|:||..|             |.|||.|
  Rat    68 LMDGGALPRLVPTSSGVAGACTARRRPP--SPELLRCSRRRRSGATEASSSSAAVARRNERERNR 130

  Fly   268 MQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            ::.:|..|..|||::|..|.:::|||.|||:.|..||.||..||
  Rat   131 VKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYIRALQRLL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 28/76 (37%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 10/42 (24%)
bHLH_TS_ASCL2_Mash2 128..180 CDD:381586 22/47 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.