DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Myf6

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_032683.1 Gene:Myf6 / 17878 MGIID:97253 Length:242 Species:Mus musculus


Alignment Length:146 Identity:45/146 - (30%)
Similarity:64/146 - (43%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFD-LADGENQDAAAGGSGKKR----RGK 246
            |...|.:|..|        :.|.:..|...:.|:||:.. ..|...|:|.:..||::.    .|.
Mouse    12 FFYLDGENVTL--------QPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLAPPGL 68

  Fly   247 Q-----------ITPVVKRK-----RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHE 295
            |           .....|||     ||.||..|||||::.:|:||:.|::......|.| |.|.|
Mouse    69 QPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQR-LPKVE 132

  Fly   296 TLQMAQTYISALGDLL 311
            .|:.|.:||..|.|||
Mouse   133 ILRSAISYIERLQDLL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/64 (45%)
Myf6NP_032683.1 Basic 3..93 CDD:279868 19/88 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 8/31 (26%)
HLH 94..145 CDD:278439 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.