DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod4

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001124513.1 Gene:neurod4 / 100124310 XenbaseID:XB-GENE-972704 Length:316 Species:Xenopus tropicalis


Alignment Length:100 Identity:41/100 - (41%)
Similarity:55/100 - (55%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVK------RKRRLAANARERRRMQNLNQAFD 276
            ||.|...:..|||.         .|:||.:...:.|      |.||:.||||||.||..||.|.:
 Frog    45 DGEDDDEEEEDGEK---------PKKRGPKKKKMTKARLERFRVRRVKANARERTRMHGLNDALE 100

  Fly   277 RLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .||:.:||....::|||.|||::|:.||.||.|:|
 Frog   101 NLRRVMPCYSKTQKLSKIETLRLARNYIWALSDIL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 31/66 (47%)
neurod4NP_001124513.1 bHLH_TS_NeuroD4_ATOH3 <69..137 CDD:381564 31/66 (47%)
Neuro_bHLH 138..256 CDD:463621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.