DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and AT1G35710

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_174809.1 Gene:AT1G35710 AraportID:AT1G35710 Length:1120 Species:Arabidopsis thaliana

Alignment Length:530 Identity:128/531 (24%)
Similarity:197/531 (37%) Gaps:120/531 (23%)


  Fly    68 LELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFK 132
            |||.|........:.|..|..||.|.|....|.|:.........:|..|.|..|.:|......|.
plant   323 LELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFG 387

  Fly   133 GLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTW 197
            .|..|..|.|..|.:.|:......|:..:::||||.|::.....:.|....|||.|.|..|.|:.
plant   388 NLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSG 452

  Fly   198 IAPTSLKSLSNLR--LLDMSN---------C----------------GPLPDLSLPGAHTLI--- 232
            ..|..:.:.|:|.  :||.:|         |                ||:|. ||....:||   
plant   453 AIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPK-SLRDCKSLIRAR 516

  Fly   233 -LDNS---------GV-QRLDILGSVH---------------KLQA---RKNHIT---EIKLPDK 265
             |.|.         |: ..|:.:...|               ||.|   ..|:||   ..::.:.
plant   517 FLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNM 581

  Fly   266 SSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSA 330
            :.::||||.:|.|.. ::|:.:..:..|.||.|:.|.:.....||      |..|.||..::||:
plant   582 TQLVELDLSTNNLFG-ELPEAIGNLTNLSRLRLNGNQLSGRVPAG------LSFLTNLESLDLSS 639

  Fly   331 N-------------------RLTRLHFDSPIP----WERLTHLDASYNRIYAPAKVGIDEAFNLQ 372
            |                   .|:|..||..||    ..:||.||.|:|::.......:....:|.
plant   640 NNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPRLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLD 704

  Fly   373 SLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTT 437
            .|.|..|.::....|.::...:|..|.:.:||.:  |....|..|.:...:.||:.....||...
plant   705 KLDLSHNNLSGLIPTTFEGMIALTNVDISNNKLE--GPLPDTPTFRKATADALEENIGLCSNIPK 767

  Fly   438 PTCKPCIPDARDFPTSISADTNQTIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVKLI 502
            ...|||    |:..               .|..|....  ||.::.::.::|.|.:.:......|
plant   768 QRLKPC----RELK---------------KPKKNGNLV--VWILVPILGVLVILSICANTFTYCI 811

  Fly   503 RLR----GRN 508
            |.|    |||
plant   812 RKRKLQNGRN 821

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380
leucine-rich repeat 65..85 CDD:275380 5/17 (29%)
LRR_8 87..147 CDD:290566 17/60 (28%)
leucine-rich repeat 89..112 CDD:275380 6/23 (26%)
leucine-rich repeat 113..136 CDD:275380 7/23 (30%)
LRR_RI <131..334 CDD:238064 68/284 (24%)
leucine-rich repeat 137..160 CDD:275380 6/23 (26%)
LRR_8 140..195 CDD:290566 17/55 (31%)
leucine-rich repeat 161..184 CDD:275380 6/23 (26%)
leucine-rich repeat 185..208 CDD:275380 8/23 (35%)
leucine-rich repeat 209..246 CDD:275380 16/78 (21%)
leucine-rich repeat 247..267 CDD:275380 7/41 (17%)
leucine-rich repeat 268..292 CDD:275380 7/24 (29%)
leucine-rich repeat 293..322 CDD:275380 9/29 (31%)
leucine-rich repeat 395..406 CDD:275378 4/11 (36%)
AT1G35710NP_174809.1 PLN00113 33..1118 CDD:215061 128/531 (24%)
leucine-rich repeat 79..103 CDD:275380
LRR_RI 104..283 CDD:238064
leucine-rich repeat 104..127 CDD:275380
leucine-rich repeat 128..151 CDD:275380
leucine-rich repeat 152..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..247 CDD:275380
leucine-rich repeat 248..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 320..341 CDD:275380 5/18 (28%)
leucine-rich repeat 344..367 CDD:275380 6/23 (26%)
leucine-rich repeat 368..415 CDD:275380 13/47 (28%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..460 CDD:275380 7/20 (35%)
leucine-rich repeat 464..483 CDD:275380 4/19 (21%)
leucine-rich repeat 488..535 CDD:275380 10/48 (21%)
leucine-rich repeat 540..559 CDD:275380 1/19 (5%)
leucine-rich repeat 560..583 CDD:275380 5/23 (22%)
LRR_RI 583..>761 CDD:238064 47/187 (25%)
leucine-rich repeat 584..607 CDD:275380 7/24 (29%)
leucine-rich repeat 608..631 CDD:275380 9/29 (31%)
leucine-rich repeat 632..655 CDD:275380 4/23 (17%)
leucine-rich repeat 679..702 CDD:275380 6/23 (26%)
leucine-rich repeat 703..726 CDD:275380 5/23 (22%)
PKc_like 857..1112 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.