DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and cDIP

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster

Alignment Length:560 Identity:128/561 (23%)
Similarity:207/561 (37%) Gaps:159/561 (28%)


  Fly     8 LLASVSALGRPD-------------------LEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDS 53
            ||.|::|....|                   ||.:|.             ::.|.|....|....
  Fly    14 LLISLAATATTDEDADADVDSGSSRIVLVSSLEGHCQ-------------TEGKVTSCRGFEFAG 65

  Fly    54 CEKKVLKLMP------------------NLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLL 100
            .::|....:|                  :.|||..|||...:|.:.....|. ::.|.:|...:.
  Fly    66 EDEKATFDLPTEVRIAEDGTTYEVGDEEHSRTLIFENCTFTNFPLRLFYTLE-VSELDMRGCGIR 129

  Fly   101 GLHDEHFSKWPN-MKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHL 164
            .::.|:||...: :.||:|..|:|..|..:.|:|...|..:.|..|.:..|....|.||.:|.:|
  Fly   130 FIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYL 194

  Fly   165 DLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIA-------PTSLK-SLSNLRL---------- 211
            ||:.||:|.|..::|.|:..|..:.|.||.||.|.       |..|. ::.|.||          
  Fly   195 DLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRS 259

  Fly   212 ---------LDMSNCGPLPDLSLP-GAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKS 266
                     :|:||...|..|.|. .|..|...|..:.|:::.|||..:....|.:.|:..|...
  Fly   260 RGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRVRELYFPASE 324

  Fly   267 SVIELDLHSN----LLTATDIPKL----------------------------------------L 287
            ::..|.|.:|    |.:.:.:|:|                                        |
  Fly   325 ALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEAL 389

  Fly   288 TGMWRLQRLDLSENIIGIYAAAGSDNTSEL------------FILPNLMYMNLSANRL--TRLHF 338
            .||..||:||:|.|.:.....:.....::|            |.|.|:|.:.:.||.:  |..::
  Fly   390 QGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNY 454

  Fly   339 DSPIPWERLTHLDASYNRIYAPAKVGIDEAFNLQ-SLHLEGNYINNFELTPWKPHPS-------- 394
            |...|.|....:...|.   .|.|.|:|.:.:.: |..:|.:.|.:      ...||        
  Fly   455 DPDFPGEYFHGIACMYR---LPEKEGVDSSSSSEISASVESSPITS------SSDPSEVDKLRDE 510

  Fly   395 LKEVAL-YDNKFQPKGYKNITKFFNEI-GVNVLEKTQYSQ 432
            ||.|.. :|:||. ..:..:.:...:| ...||.||.:||
  Fly   511 LKAVVQHFDSKFD-LIFSKLAQLNEQIQAFEVLNKTVWSQ 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/36 (8%)
leucine-rich repeat 65..85 CDD:275380 7/20 (35%)
LRR_8 87..147 CDD:290566 16/61 (26%)
leucine-rich repeat 89..112 CDD:275380 5/23 (22%)
leucine-rich repeat 113..136 CDD:275380 8/23 (35%)
LRR_RI <131..334 CDD:238064 69/289 (24%)
leucine-rich repeat 137..160 CDD:275380 7/23 (30%)
LRR_8 140..195 CDD:290566 20/55 (36%)
leucine-rich repeat 161..184 CDD:275380 10/23 (43%)
leucine-rich repeat 185..208 CDD:275380 9/31 (29%)
leucine-rich repeat 209..246 CDD:275380 13/57 (23%)
leucine-rich repeat 247..267 CDD:275380 4/20 (20%)
leucine-rich repeat 268..292 CDD:275380 9/68 (13%)
leucine-rich repeat 293..322 CDD:275380 9/41 (22%)
leucine-rich repeat 395..406 CDD:275378 6/12 (50%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 5/24 (21%)
LRR_RI 143..407 CDD:238064 68/264 (26%)
leucine-rich repeat 143..166 CDD:275380 8/23 (35%)
LRR_8 166..225 CDD:290566 21/59 (36%)
leucine-rich repeat 167..190 CDD:275380 7/23 (30%)
leucine-rich repeat 191..214 CDD:275380 10/23 (43%)
leucine-rich repeat 215..238 CDD:275380 8/23 (35%)
leucine-rich repeat 239..265 CDD:275380 4/26 (15%)
leucine-rich repeat 266..325 CDD:275380 16/59 (27%)
LRR_8 304..357 CDD:290566 11/53 (21%)
leucine-rich repeat 326..347 CDD:275380 5/21 (24%)
leucine-rich repeat 348..394 CDD:275380 4/46 (9%)
LRR_8 369..428 CDD:290566 10/59 (17%)
LRR_4 393..433 CDD:289563 8/40 (20%)
leucine-rich repeat 395..418 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140860216
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.