DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and 2mit

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001262529.1 Gene:2mit FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster

Alignment Length:423 Identity:100/424 (24%)
Similarity:170/424 (40%) Gaps:67/424 (16%)


  Fly    37 TFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLELEN--CDSPDFTMNDLN-QLPYLTSLQLRRGN 98
            |..|..:.:|....:|:..:        ||.|:|.|  .:....::.|.| .||::| |.|....
  Fly   124 TAMDLSSNQLESLSLDNFNQ--------LRQLDLGNNSLEVIPLSLADTNMSLPFVT-LDLSCNK 179

  Fly    99 LLGLHDEHFS-KWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELL 162
            ...:....|: :.|.:|.|.|..|.:..:|.|.|..|.:|..|.|..|.|..:.::.|..||.|.
  Fly   180 FSQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLALPNLQ 244

  Fly   163 HLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPG 227
            :||||.||:.........|:|.|..|.:..||...:|.....:..:|:.||.|..|.   ..:|.
  Fly   245 YLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTGL---CQVPA 306

  Fly   228 AHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSS---VIELDL-HSNLLTATDIPKLLT 288
            |              :..||..|:...|.:..|...|..|   :..||| ||.:....|     .
  Fly   307 A--------------LAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVED-----D 352

  Fly   289 GMWRLQRLD---LSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHL 350
            .:.||:.|:   |..|::....::         :.|:|.::.|..|::..|...:.:....|..|
  Fly   353 ALGRLELLESLFLDRNLLMRVPSS---------LPPSLEHLFLQHNQIMELPPQAFVGLVNLQTL 408

  Fly   351 DASYNRIYAPAKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITK 415
            |.|.||:.....:.:.:   |.:|:||.:.:.:...:.....|.|:::.|.||..:......|.:
  Fly   409 DLSNNRLIFLPPLSLPK---LLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAE 470

  Fly   416 FFN-------------EIGVNVLEKTQYSQSNN 435
            :.:             .:...|..||:|.|.:|
  Fly   471 WASPCRSVDAGQSNGASVSGRVDLKTEYLQFHN 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 2/18 (11%)
leucine-rich repeat 65..85 CDD:275380 7/23 (30%)
LRR_8 87..147 CDD:290566 18/61 (30%)
leucine-rich repeat 89..112 CDD:275380 5/24 (21%)
leucine-rich repeat 113..136 CDD:275380 8/23 (35%)
LRR_RI <131..334 CDD:238064 53/210 (25%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 20/55 (36%)
leucine-rich repeat 161..184 CDD:275380 9/23 (39%)
leucine-rich repeat 185..208 CDD:275380 5/23 (22%)
leucine-rich repeat 209..246 CDD:275380 7/37 (19%)
leucine-rich repeat 247..267 CDD:275380 5/20 (25%)
leucine-rich repeat 268..292 CDD:275380 6/25 (24%)
leucine-rich repeat 293..322 CDD:275380 5/32 (16%)
leucine-rich repeat 395..406 CDD:275378 4/11 (36%)
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 68/262 (26%)
leucine-rich repeat 124..143 CDD:275380 4/19 (21%)
leucine-rich repeat 144..167 CDD:275380 7/23 (30%)
leucine-rich repeat 172..194 CDD:275380 5/23 (22%)
LRR_8 193..253 CDD:290566 24/60 (40%)
leucine-rich repeat 195..218 CDD:275380 8/23 (35%)
leucine-rich repeat 219..242 CDD:275380 8/23 (35%)
LRR_8 241..301 CDD:290566 20/60 (33%)
leucine-rich repeat 243..311 CDD:275380 21/85 (25%)
leucine-rich repeat 312..335 CDD:275380 6/23 (26%)
LRR_8 334..415 CDD:290566 22/95 (23%)
leucine-rich repeat 336..359 CDD:275380 8/28 (29%)
leucine-rich repeat 360..380 CDD:275380 4/29 (14%)
LRR_8 379..460 CDD:290566 20/84 (24%)
LRR_4 379..>415 CDD:289563 11/36 (31%)
leucine-rich repeat 381..404 CDD:275380 4/23 (17%)
leucine-rich repeat 405..449 CDD:275380 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19488174
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.