DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and CG18249

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster

Alignment Length:561 Identity:202/562 (36%)
Similarity:295/562 (52%) Gaps:48/562 (9%)


  Fly     3 LIIIALLASVSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKK-----VLKLM 62
            |.:...||...|.||.:|...|.||:|.|..|...:|...|.:|.|.|:.:|.::     ||:|.
  Fly    14 LTVSDALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLRELHLRNCSRQSITWLVLQLT 78

  Fly    63 PNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLS 127
            |.||||.:.||.:...:...|..:..|||||::..:|..|.|:.|:..|.::||.|..|.|..:.
  Fly    79 PGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVH 143

  Fly   128 NECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNG 192
            ...|:||::|.||.|.||.|..:.......|.||:|||||.|.:.||.:|||....||:.|||||
  Fly   144 VAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNG 208

  Fly   193 NPLTWIAPTSLKSLSNLRLLDMSNCGPLP--DLSLPGAHTLILDNSGVQRLDILGSVHKLQARKN 255
            |||..:.|..|.||.||||||:.:...|.  .|:|.....|:|:.|.:..|.|.|...||||..|
  Fly   209 NPLRILMPDVLGSLPNLRLLDLGHAAELEVMTLNLTNVQNLVLEGSSLSSLVINGGFIKLQAGNN 273

  Fly   256 HITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGS----DNTSE 316
            .:..:::.:||||||:|||.|||...|...||.|||.|||||||:|.|......||    ..|.|
  Fly   274 ELNHLQVGNKSSVIEMDLHGNLLNGNDTAALLRGMWNLQRLDLSKNRIEALPQHGSGLDASGTQE 338

  Fly   317 LFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAPAKVGIDEAFN-LQSLHLEGNY 380
            |.|||:|.::||:.|:|.||..:|||...||::||.|:| :.....|.|..:.: |:.|::|||.
  Fly   339 LLILPSLKFLNLANNQLVRLPPESPILSSRLSYLDLSHN-LMLTLDVAILRSLSVLKGLYVEGNR 402

  Fly   381 IN--NFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPC 443
            :|  |::.. .:.||.|.|:.|:||.:....|:.:..:|.:.||::..:.|....|.::..    
  Fly   403 LNTINYQKL-HEEHPDLSELGLHDNPWSSGLYRKMFLYFTDRGVHLQARPQNRVLNKSSRV---- 462

  Fly   444 IPDARDFPTSISADTNQTID----TKVNPLSNDTYQWNVWNVLMLVSLIV---SLFVNSFLIVK- 500
              |. |:|.:......|.:|    |.::|      .|.:.::|..|:|:|   .|.:|.:.|:: 
  Fly   463 --DI-DWPPNEGQAEAQKMDPPGVTGIHP------YWTLRDILAFVTLLVVMIILLMNLYHILEE 518

  Fly   501 ---LIRLR--------GRNQFTQSSSVPAIIEMFSNESDDE 530
               |.|.|        |:|..|..:|...:.|..|.:|..|
  Fly   519 EGCLRRFRHWRRSRTLGQNTSTTRNSGRRLDEQDSEQSSSE 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 8/23 (35%)
leucine-rich repeat 65..85 CDD:275380 7/20 (35%)
LRR_8 87..147 CDD:290566 24/60 (40%)
leucine-rich repeat 89..112 CDD:275380 10/23 (43%)
leucine-rich repeat 113..136 CDD:275380 8/23 (35%)
LRR_RI <131..334 CDD:238064 98/209 (47%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 28/55 (51%)
leucine-rich repeat 161..184 CDD:275380 12/23 (52%)
leucine-rich repeat 185..208 CDD:275380 13/23 (57%)
leucine-rich repeat 209..246 CDD:275380 14/39 (36%)
leucine-rich repeat 247..267 CDD:275380 7/20 (35%)
leucine-rich repeat 268..292 CDD:275380 15/24 (63%)
leucine-rich repeat 293..322 CDD:275380 17/33 (52%)
leucine-rich repeat 395..406 CDD:275378 5/11 (45%)
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380 8/23 (35%)
LRR_8 104..163 CDD:290566 24/59 (41%)
leucine-rich repeat 105..128 CDD:275380 10/23 (43%)
LRR_RI 107..438 CDD:238064 139/333 (42%)
leucine-rich repeat 129..152 CDD:275380 8/23 (35%)
leucine-rich repeat 153..176 CDD:275380 8/23 (35%)
LRR_8 176..232 CDD:290566 33/56 (59%)
leucine-rich repeat 177..200 CDD:275380 12/23 (52%)
leucine-rich repeat 201..224 CDD:275380 13/23 (57%)
leucine-rich repeat 225..258 CDD:275380 11/33 (33%)
leucine-rich repeat 259..310 CDD:275380 26/51 (51%)
leucine-rich repeat 311..344 CDD:275380 17/33 (52%)
LRR_8 343..403 CDD:290566 24/61 (39%)
leucine-rich repeat 345..368 CDD:275380 10/23 (43%)
leucine-rich repeat 369..390 CDD:275380 7/22 (32%)
leucine-rich repeat 393..417 CDD:275380 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140860176
eggNOG 1 0.900 E33208_3C6YN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.