DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and CG4950

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001261934.1 Gene:CG4950 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster

Alignment Length:589 Identity:133/590 (23%)
Similarity:228/590 (39%) Gaps:118/590 (20%)


  Fly     3 LIIIALLASVSALGR-PDLEDYC-----------NDSYCHLLGRSRTFSDK---------KATKL 46
            :|:|.:||..|..|. .|:...|           |:::|.:.|.:.|.|..         ...|.
  Fly    10 VIVILILAISSCDGSGGDIPLRCDEYDSMGYMDVNEAFCTVTGFTVTHSQNVVIKNIPPGNMVKF 74

  Fly    47 TEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWP 111
            .:|:     :..|..||                .:.....|||.:|.:...|:|.|....||...
  Fly    75 MKFY-----ESTLLYMP----------------FHLFETFPYLKTLDVSNTNILELTRNAFSAAS 118

  Fly   112 NMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHE 176
            |:..|.|..||:|.:....|.|...|..|.|..|.|..|..:.|..|..:..:.|:||.::.||.
  Fly   119 NLTYLNLAYNNLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHN 183

  Fly   177 NIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPL---PDLSLPGA---------- 228
            :||.....||.:...||.||.|.|...:::..::.:::||...:   ||.....|          
  Fly   184 DIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYN 248

  Fly   229 -------------HTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTA 280
                         |.|.|||:.:..|.| .:...::|..|.|:|:.|.....:..|||.:|.|::
  Fly   249 ELKNFQLTEKNIVHQLHLDNNYLTNLTI-NATRFVRASHNQISELFLHQSLHIETLDLSANKLSS 312

  Fly   281 TDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWE 345
            .   ..:|.:..:..||:|:|.||..      |.|....|..|..:||....:..|.|......:
  Fly   313 I---SNITNITHMLYLDVSDNPIGPL------NISTFSQLKRLRGLNLRGTGIRELKFGMFSKQK 368

  Fly   346 RLTHLDASYNRI-------YAPAKVGIDEAFNLQSLHLEGNYINNFE--LTPWKPHPSLKEVALY 401
            .|..||.|:|.:       :.|...      ||:...::||.:...:  .|..:..|.|:::.:.
  Fly   369 YLEELDLSFNNLTILNLDMFVPYLT------NLKKFLIDGNGLTELQGNRTFSEAFPQLQKLGVS 427

  Fly   402 DNKFQPKGYKNI---TKFFNEIGVNVLEKTQYSQSNNTTPTCK--PCIPDARDFPTSISADTNQT 461
            .|:|......::   ......:.:|:...|...:    ||..:  .||..:::...:........
  Fly   428 RNRFNCSYLHHLLIPPSLPESVVLNIEPDTNLDE----TPHIRDVSCISQSQEVVNASFTAEESK 488

  Fly   462 IDTKVNPLSND-----TYQWNVWNVLMLVSLIVSLFVNSFL----IVKLIRLRG-RNQ----FTQ 512
            :::::..||..     ::..|:  .|.|..:.:..:|...|    :|.||.||. :||    :.:
  Fly   489 LESQIQMLSKQLDIVGSHSKNL--ELHLAFMQIFAYVMGGLVLVGVVSLITLRYLKNQRSGRYDR 551

  Fly   513 SSSV 516
            ||.|
  Fly   552 SSIV 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 4/18 (22%)
leucine-rich repeat 65..85 CDD:275380 0/20 (0%)
LRR_8 87..147 CDD:290566 21/60 (35%)
leucine-rich repeat 89..112 CDD:275380 7/23 (30%)
leucine-rich repeat 113..136 CDD:275380 7/23 (30%)
LRR_RI <131..334 CDD:238064 60/229 (26%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 18/55 (33%)
leucine-rich repeat 161..184 CDD:275380 7/23 (30%)
leucine-rich repeat 185..208 CDD:275380 8/23 (35%)
leucine-rich repeat 209..246 CDD:275380 12/63 (19%)
leucine-rich repeat 247..267 CDD:275380 5/20 (25%)
leucine-rich repeat 268..292 CDD:275380 6/24 (25%)
leucine-rich repeat 293..322 CDD:275380 9/29 (31%)
leucine-rich repeat 395..406 CDD:275378 3/11 (27%)
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 7/23 (30%)
LRR_8 118..178 CDD:290566 19/60 (32%)
leucine-rich repeat 120..143 CDD:275380 7/23 (30%)
leucine-rich repeat 144..167 CDD:275380 8/23 (35%)
leucine-rich repeat 168..191 CDD:275380 7/23 (30%)
LRR_8 192..250 CDD:290566 13/58 (22%)
leucine-rich repeat 192..215 CDD:275380 8/23 (35%)
LRR_RI <207..432 CDD:238064 53/241 (22%)
leucine-rich repeat 216..239 CDD:275380 5/23 (22%)
leucine-rich repeat 240..299 CDD:275380 12/60 (20%)
LRR_8 299..356 CDD:290566 18/66 (27%)
leucine-rich repeat 300..321 CDD:275380 6/24 (25%)
leucine-rich repeat 322..345 CDD:275380 9/29 (31%)
LRR_8 344..405 CDD:290566 15/67 (22%)
leucine-rich repeat 346..365 CDD:275380 5/19 (26%)
leucine-rich repeat 370..394 CDD:275380 6/30 (20%)
leucine-rich repeat 395..420 CDD:275380 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19495435
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.