DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and CG4781

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster

Alignment Length:539 Identity:128/540 (24%)
Similarity:199/540 (37%) Gaps:152/540 (28%)


  Fly     3 LIIIALLAS-VSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKKVLKLMP-NL 65
            |::..|||: |:.....|.|:  .|.:|:      ..|.|.:.:       |||...:...| ..
  Fly    14 LLLTQLLAAHVARAEVIDAEE--TDRFCY------PESSKNSRR-------SCECSNVSASPWGN 63

  Fly    66 RTLELENC------------------DSPDFTMNDLNQLPYLTS-----LQLRRGNLLGLHDEHF 107
            |.|.:: |                  ||.|.:.|.|:.:|..||     |.||..|:..|...:|
  Fly    64 RALRID-CSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNF 127

  Fly   108 SKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIE 172
            .:..:::.|.||.|:|.:|.:..|.||..|.:|.|..|.:..||..:|..|..|..||:|.||  
  Fly   128 KQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNR-- 190

  Fly   173 TLHE---NIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILD 234
            ..:|   :::||:           .:.|       .||.|||   ..|. |.||.||        
  Fly   191 RFNESGGDLYTGL-----------GVNW-------KLSTLRL---DACS-LNDLHLP-------- 225

  Fly   235 NSGVQRLDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLS 299
                    :...:.:|..|:|.:..|                   .|.:|:.|.      |||:|
  Fly   226 --------VNAPLKELSLRRNQLKRI-------------------PTQLPETLL------RLDIS 257

  Fly   300 ENIIGIYAAAGSDNTS---ELFILPNLMYMNLSANRLTRLHFDSPIPWE---RLTHLDASYNRIY 358
            :|::.......:.|.:   :|||....:...:.||.||.:.....:.::   :|:||||   ..:
  Fly   258 DNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDA---EAF 319

  Fly   359 APAKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVN 423
            .|......:...|:||...|..:..|..|   ..|...::|..|....|........:..::.| 
  Fly   320 GPIMTTPTKKRALRSLSFRGTMLRTFNST---LAPIFTQLAELDLNGLPLQCDCELVWLKQLPV- 380

  Fly   424 VLEKTQYSQSNNTTPTCKPCIPDAR---DFPTSISADTNQTIDTKVNPLSNDTYQWNVWNV-LML 484
                    |:|..      |...||   ...||...|.          .|.||  |..|.. |::
  Fly   381 --------QTNGR------CYKPARIRGMLVTSARGDA----------FSCDT--WPRWAYGLVV 419

  Fly   485 VSLIVSLFVNSFLIVKLIR 503
            :|||.......:|||..:|
  Fly   420 LSLIALSAAGIYLIVMGLR 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 4/19 (21%)
leucine-rich repeat 65..85 CDD:275380 8/38 (21%)
LRR_8 87..147 CDD:290566 22/65 (34%)
leucine-rich repeat 89..112 CDD:275380 8/28 (29%)
leucine-rich repeat 113..136 CDD:275380 9/23 (39%)
LRR_RI <131..334 CDD:238064 51/209 (24%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 16/58 (28%)
leucine-rich repeat 161..184 CDD:275380 9/26 (35%)
leucine-rich repeat 185..208 CDD:275380 3/23 (13%)
leucine-rich repeat 209..246 CDD:275380 9/37 (24%)
leucine-rich repeat 247..267 CDD:275380 4/20 (20%)
leucine-rich repeat 268..292 CDD:275380 3/24 (13%)
leucine-rich repeat 293..322 CDD:275380 9/32 (28%)
leucine-rich repeat 395..406 CDD:275378 2/11 (18%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 7/18 (39%)
LRR_8 108..167 CDD:290566 19/59 (32%)
leucine-rich repeat 109..132 CDD:275380 6/23 (26%)
LRR_RI <121..>261 CDD:238064 52/205 (25%)
leucine-rich repeat 133..156 CDD:275380 9/23 (39%)
leucine-rich repeat 157..180 CDD:275380 8/23 (35%)
leucine-rich repeat 181..208 CDD:275380 10/47 (21%)
leucine-rich repeat 230..253 CDD:275380 7/48 (15%)
leucine-rich repeat 254..274 CDD:275380 5/20 (25%)
leucine-rich repeat 275..299 CDD:275380 7/24 (29%)
leucine-rich repeat 300..319 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.