DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and 18w

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster

Alignment Length:655 Identity:152/656 (23%)
Similarity:229/656 (35%) Gaps:231/656 (35%)


  Fly     9 LASVSALGRPDLEDYCNDSYCHLLGRSRTFSD------KKATKLTEFHMDSCEKKVLKLMPNL-- 65
            |....|.||.||:  |:....|.       |:      ::..||:|..:|:|  |:.::.||.  
  Fly    58 LQVAEAAGRLDLQ--CSQELLHA-------SELAPGLFRQLQKLSELRIDAC--KLQRVPPNAFE 111

  Fly    66 --------------------RTLELEN---------------------------CDSP------- 76
                                :||||..                           |..|       
  Fly   112 GLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNL 176

  Fly    77 ---------------------------------------DFTMNDLNQLP---------YLTSLQ 93
                                                   |.:.|:|..||         .|.:|.
  Fly   177 TQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLS 241

  Fly    94 LRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNL 158
            |:..|:..|.....:...::::|.:..|::..|.:|.|.|..:|..|.|.||.:..||..:...|
  Fly   242 LQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRL 306

  Fly   159 PELLHLDLSGNRIETLH--ENIFTGVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSN--CGP 219
            .:||.||||||::.:.|  .:.|.|:.:|.:|.|:.|.||.|...:.|.|..|::|||.|  .|.
  Fly   307 EQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGH 371

  Fly   220 LPD---LSLPGAHTLILDNSGVQRLD--ILGSVH---KLQARKNHITEIK---LPDKSSVIELDL 273
            :.:   |.|...|||.|..:.:..||  |...::   ||....|.::.::   ..:.|.:.||||
  Fly   372 IEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDL 436

  Fly   274 HSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELF------------------IL 320
            .||.|  |::|:.:..:..|:.|||.||.|..:......|.::|.                  .|
  Fly   437 SSNQL--TEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDL 499

  Fly   321 PNLMYMNLSANRLTRLH---FDSPIPWERLTHLDASY----NRIYAPAK------------VGID 366
            |.|..:||:.||:..:.   ||.....|.: .||.::    |.|:|...            |..|
  Fly   500 PRLSVLNLAKNRIQSIERGAFDKNTEIEAI-RLDKNFLTDINGIFATLASLLWLNLSENHLVWFD 563

  Fly   367 EAF---NLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKT 428
            .||   ||:.|.:.||||                          :...|..|...||.|..|:  
  Fly   564 YAFIPSNLKWLDIHGNYI--------------------------EALGNYYKLQEEIRVTTLD-- 600

  Fly   429 QYSQSNNTTPTCKPCIPDARDFPTSI-----------SADTNQTIDTKVNPLSNDTYQWNVWNVL 482
              :..|..|..      .|...|.||           ....|..:| |......|.|.    |||
  Fly   601 --ASHNRITEI------GAMSVPNSIELLFINNNIIGQIQANTFVD-KTRLARVDLYA----NVL 652

  Fly   483 MLVSL 487
            ..:||
  Fly   653 SKISL 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 6/18 (33%)
leucine-rich repeat 65..85 CDD:275380 9/115 (8%)
LRR_8 87..147 CDD:290566 17/69 (25%)
leucine-rich repeat 89..112 CDD:275380 5/23 (22%)
leucine-rich repeat 113..136 CDD:275380 6/23 (26%)
LRR_RI <131..334 CDD:238064 74/236 (31%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 22/57 (39%)
leucine-rich repeat 161..184 CDD:275380 11/25 (44%)
leucine-rich repeat 185..208 CDD:275380 9/23 (39%)
leucine-rich repeat 209..246 CDD:275380 15/44 (34%)
leucine-rich repeat 247..267 CDD:275380 4/26 (15%)
leucine-rich repeat 268..292 CDD:275380 9/24 (38%)
leucine-rich repeat 293..322 CDD:275380 11/47 (23%)
leucine-rich repeat 395..406 CDD:275378 0/11 (0%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 6/34 (18%)
leucine-rich repeat 92..115 CDD:275380 7/25 (28%)
LRR_8 115..181 CDD:290566 6/66 (9%)
leucine-rich repeat 116..146 CDD:275380 4/30 (13%)
leucine-rich repeat 147..170 CDD:275380 2/23 (9%)
leucine-rich repeat 171..201 CDD:275380 0/30 (0%)
LRR_RI 210..464 CDD:238064 78/256 (30%)
leucine-rich repeat 212..236 CDD:275380 5/24 (21%)
LRR_8 235..295 CDD:290566 16/60 (27%)
leucine-rich repeat 237..260 CDD:275380 5/23 (22%)
leucine-rich repeat 261..284 CDD:275380 6/23 (26%)
LRR_8 283..345 CDD:290566 23/62 (37%)
leucine-rich repeat 285..308 CDD:275380 8/23 (35%)
leucine-rich repeat 309..334 CDD:275380 11/25 (44%)
LRR_8 334..393 CDD:290566 21/59 (36%)
leucine-rich repeat 335..358 CDD:275380 9/23 (39%)
leucine-rich repeat 359..382 CDD:275380 8/23 (35%)
LRR_8 382..441 CDD:290566 17/59 (29%)
leucine-rich repeat 383..406 CDD:275380 7/23 (30%)
leucine-rich repeat 407..430 CDD:275380 4/23 (17%)
LRR_8 431..488 CDD:290566 18/59 (31%)
leucine-rich repeat 431..451 CDD:275380 9/22 (41%)
leucine-rich repeat 454..477 CDD:275380 8/23 (35%)
LRR_8 477..559 CDD:290566 16/83 (19%)
leucine-rich repeat 478..499 CDD:275380 1/21 (5%)
leucine-rich repeat 502..525 CDD:275380 7/23 (30%)
leucine-rich repeat 526..548 CDD:275380 6/23 (26%)
leucine-rich repeat 590..617 CDD:275380 8/37 (22%)
leucine-rich repeat 618..641 CDD:275380 4/24 (17%)
leucine-rich repeat 642..689 CDD:275380 7/21 (33%)
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19492985
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.