DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and CG4168

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001285953.1 Gene:CG4168 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster

Alignment Length:556 Identity:129/557 (23%)
Similarity:208/557 (37%) Gaps:154/557 (28%)


  Fly    25 NDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYL 89
            |.|:.|:    .:|.|:.::.:..:.:|.....|.|              |..|| |..|.|.: 
  Fly   743 NVSHNHI----ASFYDELSSYMYIYQLDISHNHVTK--------------SDSFT-NLANTLRF- 787

  Fly    90 TSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDV 154
              |.|....|..|....|.....::||.:..||:|.|....|:||..|..|.|..|.:..|..:.
  Fly   788 --LNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQ 850

  Fly   155 FQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLT-WIAPT------SLKSL----SN 208
            |.||.:|..|.::.||:..|...:|... :||.|.:..|.|: |..|.      :|:|:    :|
  Fly   851 FSNLRKLRILRINSNRLRALPREVFMNT-RLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHNN 914

  Fly   209 LRLLDMS---NCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDK----- 265
            |..||.|   |...|.|:||                           .:|.||  .|||.     
  Fly   915 LEYLDASMFINSQFLYDISL---------------------------ARNRIT--ILPDNTFSFL 950

  Fly   266 SSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGSDNTSELFILPNLMYMNLSA 330
            :::..|||..|.|..|::.::.....||::|.|..  :|:|....       ..||.|.|:::|.
  Fly   951 NNLTNLDLSQNPLVTTNLREVFVHTPRLRKLSLHH--MGLYVLPP-------LKLPLLSYLDVSG 1006

  Fly   331 NRLTRLHFDSPI-PWERLTHLDASYNRI--------YAPAKVGI-DEAFN---------LQSL-H 375
            |.|..|   ||: ....|.|::.|:|::        :.|..|.: |.|.|         |.|| |
  Fly  1007 NYLQEL---SPLGSLRHLRHVNVSHNKLTNASCAAEHLPPSVRVLDLAHNPLRRITLHDLASLRH 1068

  Fly   376 LEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKF------FNEIGVNVLEKTQYSQ-- 432
            |....|.:.::|..:....|:.:    .|.....:.|:.:.      ..::.|:.||.....|  
  Fly  1069 LAELNILDVKVTNPQAFSKLRSL----RKLHASSHANLGEIVARIPGLQQLRVHCLEPNIGQQLF 1129

  Fly   433 ---SNNTT--------PTCKPCIPDA-------------------RDFPTSISADTNQ----TID 463
               :|||.        ...:...||.                   .|.|..|.....:    :||
  Fly  1130 AKLANNTKIRLLELYGSNVQTIAPDVFTGLSRSQRLQVKISHTRISDLPPGIFYALREVPHLSID 1194

  Fly   464 ---TKVNPLSNDTYQWN--VWNVLMLVSLIVSLFVN 494
               .::|.|:.|::..|  .|:.:...|::..|..:
  Fly  1195 ISHNRINALAADSFYPNKSYWDAVGTRSIMGGLITS 1230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/18 (17%)
leucine-rich repeat 65..85 CDD:275380 5/20 (25%)
LRR_8 87..147 CDD:290566 18/60 (30%)
leucine-rich repeat 89..112 CDD:275380 5/23 (22%)
leucine-rich repeat 113..136 CDD:275380 9/23 (39%)
LRR_RI <131..334 CDD:238064 61/222 (27%)
leucine-rich repeat 137..160 CDD:275380 8/23 (35%)
LRR_8 140..195 CDD:290566 17/55 (31%)
leucine-rich repeat 161..184 CDD:275380 6/23 (26%)
leucine-rich repeat 185..208 CDD:275380 9/34 (26%)
leucine-rich repeat 209..246 CDD:275380 9/40 (23%)
leucine-rich repeat 247..267 CDD:275380 6/25 (24%)
leucine-rich repeat 268..292 CDD:275380 6/24 (25%)
leucine-rich repeat 293..322 CDD:275380 7/29 (24%)
leucine-rich repeat 395..406 CDD:275378 2/11 (18%)
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR_RI 588..891 CDD:238064 47/171 (27%)
LRR_8 588..650 CDD:290566
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
LRR_8 638..698 CDD:290566
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
LRR_8 688..749 CDD:290566 3/6 (50%)
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380
leucine-rich repeat 740..783 CDD:275380 12/59 (20%)
LRR_8 784..843 CDD:290566 19/62 (31%)
leucine-rich repeat 785..808 CDD:275380 6/26 (23%)
leucine-rich repeat 809..832 CDD:275380 9/23 (39%)
LRR_RI <827..1053 CDD:238064 72/268 (27%)
LRR_8 832..890 CDD:290566 18/59 (31%)
leucine-rich repeat 833..856 CDD:275380 8/23 (35%)
leucine-rich repeat 857..879 CDD:275380 6/23 (26%)
leucine-rich repeat 880..900 CDD:275380 7/20 (35%)
LRR_8 904..963 CDD:290566 22/88 (25%)
leucine-rich repeat 905..928 CDD:275380 8/23 (35%)
leucine-rich repeat 929..952 CDD:275380 10/52 (19%)
leucine-rich repeat 953..977 CDD:275380 6/24 (25%)
leucine-rich repeat 978..1020 CDD:275380 15/54 (28%)
LRR_8 1019..1074 CDD:290566 14/55 (25%)
leucine-rich repeat 1045..1068 CDD:275380 7/23 (30%)
leucine-rich repeat 1069..1090 CDD:275380 4/21 (19%)
leucine-rich repeat 1091..1114 CDD:275380 2/27 (7%)
leucine-rich repeat 1115..1161 CDD:275380 9/46 (20%)
leucine-rich repeat 1162..1190 CDD:275380 3/28 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19480619
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.