DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7800 and CG5096

Sequence 1:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster

Alignment Length:562 Identity:118/563 (21%)
Similarity:176/563 (31%) Gaps:231/563 (41%)


  Fly    40 DKKATKLTEFHMDS----CEKKVLKLMPN------------LRTLELENCDSPDFTMNDLNQLPY 88
            |.|..|....::|:    |.:|:...:..            .:|:.||:        |:|..:|.
  Fly    43 DSKLCKKCNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEH--------NNLTSVPI 99

  Fly    89 LTSLQLRRGNLLGLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGL--- 150
            |....:..                   |.|..|.|..:|...|:.|.:|..|.|..|.:...   
  Fly   100 LPKYDVEN-------------------LYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLV 145

  Fly   151 ------PWDV--FQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNP---LTWIAPTSLK 204
                  |:.|  |::|..|..|:|..|.:.:|..::|..:|.:|.|:|..|.   :..::.|::.
  Fly   146 PDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAIS 210

  Fly   205 SLSNLRLLDMS--NCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQARKNHITEIKLPDKSS 267
            .|.:|::||:|  ....|||..|.|...|                           ||.:     
  Fly   211 GLQSLKILDVSYMEIDDLPDTILHGPRDL---------------------------EIFI----- 243

  Fly   268 VIELDLHSNLLTATDIPKLLTGMWRLQRLDLS----ENIIGIYAAAGSDNTSELFILPNLMYMNL 328
                 ...||.  ..:||.|.....|..|.|:    ||:||       ||     :.|       
  Fly   244 -----AAGNLF--NQLPKALKYATNLTSLVLNENPIENLIG-------DN-----VFP------- 282

  Fly   329 SANRLTRLHFDSPIPWERLTHLDASY-NRIYAPAKVGIDEAFNLQSL------------------ 374
                          |..:||||..:: :::|   |:|......||||                  
  Fly   283 --------------PLTKLTHLSMTFMSKLY---KIGPGAFSELQSLTELILSDNKLLNEIDEEA 330

  Fly   375 --------------HLEGNYINNFE--------LTPWKPHPSLKEVALYDNKFQPKGYKNITKFF 417
                          .||..|:||..        |..|....:|      |.:|.|........|.
  Fly   331 LSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKAL------DLRFNPWNCDESNDFL 389

  Fly   418 NEIGVNVLEKTQYSQSNNTTPTCKPCIPDARDF----PTSISADTNQTIDTKVNPLSNDTYQWNV 478
                :|||    ..:.|.|||..      |:|.    |..:                ||.....|
  Fly   390 ----INVL----IDRINKTTPVL------AKDVKCGGPNKL----------------NDVTLLRV 424

  Fly   479 WNVLMLVSLIVSLFVNSFLIVKLIRLRGRNQFTQSSSVPAII 520
            .|..|:.|...||.....|:|.||            :||.||
  Fly   425 ANEHMIESSTGSLIWVGLLVVLLI------------AVPTII 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/22 (14%)
leucine-rich repeat 65..85 CDD:275380 5/20 (25%)
LRR_8 87..147 CDD:290566 13/60 (22%)
leucine-rich repeat 89..112 CDD:275380 1/23 (4%)
leucine-rich repeat 113..136 CDD:275380 7/23 (30%)
LRR_RI <131..334 CDD:238064 50/223 (22%)
leucine-rich repeat 137..160 CDD:275380 8/34 (24%)
LRR_8 140..195 CDD:290566 18/69 (26%)
leucine-rich repeat 161..184 CDD:275380 7/23 (30%)
leucine-rich repeat 185..208 CDD:275380 6/26 (23%)
leucine-rich repeat 209..246 CDD:275380 10/39 (26%)
leucine-rich repeat 247..267 CDD:275380 2/20 (10%)
leucine-rich repeat 268..292 CDD:275380 5/24 (21%)
leucine-rich repeat 293..322 CDD:275380 10/33 (30%)
leucine-rich repeat 395..406 CDD:275378 3/11 (27%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 84/417 (20%)
leucine-rich repeat 85..104 CDD:275380 7/27 (26%)
LRR_8 105..174 CDD:290566 19/88 (22%)
leucine-rich repeat 105..128 CDD:275380 7/42 (17%)
leucine-rich repeat 129..163 CDD:275380 8/34 (24%)
LRR_8 163..222 CDD:290566 17/59 (29%)
leucine-rich repeat 164..187 CDD:275380 7/23 (30%)
leucine-rich repeat 188..214 CDD:275380 6/26 (23%)
leucine-rich repeat 215..238 CDD:275380 9/23 (39%)
leucine-rich repeat 239..261 CDD:275380 8/61 (13%)
LRR_8 260..322 CDD:290566 22/98 (22%)
leucine-rich repeat 262..286 CDD:275380 11/57 (19%)
leucine-rich repeat 287..311 CDD:275380 9/27 (33%)
leucine-rich repeat 346..369 CDD:275380 7/23 (30%)
leucine-rich repeat 370..388 CDD:275380 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.