DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: grn and TRPS1

Sequence 1:NP_001262366.1 Gene:grn FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_054831.2 Gene:TRPS1 HGNCID:12340 Length:1294 Species:Homo sapiens

Alignment Length:723 Identity:153/724 (21%)
Similarity:221/724 (31%) Gaps:192/724 (27%)


  Fly    23 GGSSGGGNGGGVSPQTNGLGSAGSSLAHSHHSLSSGASSAGSSVGVGSALGGGGGSGLDTSDMSA 87
            |...|....||::|:.|...|.||.:..:        ..|.||.|..........||....|.| 
Human   469 GKQHGAVQSGGLNPELNDKLSRGSVINQN--------DLAKSSEGETMTKTDKSSSGAKKKDFS- 524

  Fly    88 FYALESNGHHRRYYPSYHQHTSRMPSTHASPQVCRPHF---HTP----LSPWL------------ 133
                 |.|.......||            :.|.|...:   |.|    :.|.|            
Human   525 -----SKGAEDNMVTSY------------NCQFCDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKC 572

  Fly   134 TSEHKSFAPASAWS----MGQ----FACPQEPQVEH--------KLGQMGQSHQTTAAGQHSFPF 182
            |.:|..|.|....|    :|:    ||| ::....|        ..|..|.|.......|.||  
Human   573 TIKHCPFCPRGLCSPEKHLGEITYPFAC-RKSNCSHCALLLLHLSPGAAGSSRVKHQCHQCSF-- 634

  Fly   183 PPTPPKDSTPDSVQTGPSEYQAVMNAFMHQQATGSTSLTDASCALDIKPSIQNGSASGSSGSGTT 247
                   :||| |......|::|     |:           |.|.|:|.     .|:...||   
Human   635 -------TTPD-VDVLLFHYESV-----HE-----------SQASDVKQ-----EANHLQGS--- 667

  Fly   248 HTSTPKQREGTASTTNSSSNSSSSQQ---QQQQQQQQQQQQQQSSSNTTASSNTSASSSAAAASL 309
                    :|..|...|..:|.:...   |.:::..:..::..|.......|.|:|.:.:.....
Human   668 --------DGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAADTQSLLEHF 724

  Fly   310 SAA-VAASAATSSNGLFDGTAQAYSSGGSGGGGGGGSGSGGYDTSSYASYHHAAA---HHQAAAV 370
            :.. ......|::||..||                                ||.:   .......
Human   725 NTVHCQEQDITTANGEEDG--------------------------------HAISTIKEEPKIDF 757

  Fly   371 AAANMFQSSSVAAAAVRHSMAAAQAHHHHHHHHSGHHHSGSSSGLHGLGGSVGGTAGMGSMSGNS 435
            ...|:....|.....|..|:...:................||..|..:... |.....||.|...
Human   758 RVYNLLTPDSKMGEPVSESVVKREKLEEKDGLKEKVWTESSSDDLRNVTWR-GADILRGSPSYTQ 821

  Fly   436 GGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTSAE--GRECVNCGATSTPLWRRDGTGHYLCNAC 498
            ...|.|:..||...       ..|.:|..|...|.  .|........:....:....|.....|.
Human   822 ASLGLLTPVSGTQE-------QTKTLRDSPNVEAAHLARPIYGLAVETKGFLQGAPAGGEKSGAL 879

  Fly   499 GLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYK 563
            ...|..:|:|      |.:...|||....:.:|..||||.||.|:|||:||:|..||||||||.|
Human   880 PQQYPASGEN------KSKDESQSLLRRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQK 938

  Fly   564 LHNVNRPLTMKKEG-----IQTRNRK------LSSKSKKKKGLGGGCLPIGGHLGMGDFKPLDPS 617
            ||:..|||.:.|:.     |:.|.||      |.::...|:..|.....:.|       .||:  
Human   939 LHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNG-------SPLE-- 994

  Fly   618 KGFGGGFSASMAQHGHLSSGLHPAHAHMHGSWYTGGMGALGASSGLQGGFSTAGSLSGAVVPHSQ 682
                      .....||:.. |.....:.........|:|..|...|.....:.:|.  :....|
Human   995 ----------RRSEDHLTES-HQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLD--IHKRMQ 1046

  Fly   683 PYHLGLSS 690
            |.|:.:.|
Human  1047 PLHIQIKS 1054

Known Domains:


GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 7/49 (14%)
ZnF_GATA 473..517 CDD:238123 6/44 (14%)
ZnF_GATA 529..578 CDD:214648 29/54 (54%)
ZnF_GATA 533..583 CDD:238123 30/55 (55%)
TRPS1NP_054831.2 ZnF_GATA 904..947 CDD:214648 28/43 (65%)
ZnF_GATA 908..964 CDD:238123 31/56 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.