DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: grn and gata1a

Sequence 1:NP_001262366.1 Gene:grn FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_571309.2 Gene:gata1a ZFINID:ZDB-GENE-980526-268 Length:418 Species:Danio rerio

Alignment Length:254 Identity:135/255 (53%)
Similarity:156/255 (61%) Gaps:32/255 (13%)


  Fly   409 SGSSSGLHGLGGSVGGTAG--------MGSMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKP 465
            |||.|....|..:.||..|        .||....|....|.:.:|..|.....:....| :|.|.
Zfish   165 SGSGSSFLNLSSATGGVYGPSPHMLSPYGSYMSTSQDYSSAALYSTGGPWMSPSSYSPK-LRNKM 228

  Fly   466 RTS-AEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKR 529
            |.| .|.|||||||||:||||||||||||||||||||:||||||||||:||:||.:      :||
Zfish   229 RLSPPEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIV------SKR 287

  Fly   530 AGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKLSSKSKK-KK 593
            |||.||||.|:|||||||||||||||||||||:|||||||||||||:||||||||:|:::|| ||
Zfish   288 AGTQCANCHTSTTTLWRRNASGEPVCNACGLYFKLHNVNRPLTMKKDGIQTRNRKVSNRNKKGKK 352

  Fly   594 GLGGGCLPIGGHLGMGDFKPLDPSKGFGGGFSASMAQHGHLSSGLHPAH----AHMHGS 648
            .......|...|:.     |.|...|      |.....|.|.|..||||    :.:|.|
Zfish   353 NAASEVYPDMSHMA-----PPDEHVG------AYSLNPGPLLSYSHPAHLLPTSTLHSS 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 42/47 (89%)
ZnF_GATA 473..517 CDD:238123 40/44 (91%)
ZnF_GATA 529..578 CDD:214648 44/49 (90%)
ZnF_GATA 533..583 CDD:238123 45/50 (90%)
gata1aNP_571309.2 ZnF_GATA 237..281 CDD:238123 40/44 (91%)
ZnF_GATA 291..342 CDD:238123 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D511840at33208
OrthoFinder 1 1.000 FOG0000110
OrthoInspector 1 1.000 T596545
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10071
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.