DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and AMD2

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_010528.3 Gene:AMD2 / 851829 SGDID:S000002650 Length:549 Species:Saccharomyces cerevisiae

Alignment Length:567 Identity:134/568 (24%)
Similarity:223/568 (39%) Gaps:159/568 (28%)


  Fly    35 SGIRNPLLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQF 99
            |...|.:...:::.|...|...|::..|:.:|:..|...::..:|.:.|..|..||   :|||.:
Yeast    52 SSSENQITHSTIMALRQALEAKELSCHEITAAFCHRAALIHQVVNCLSEIMFSEAL---RLADYY 113

  Fly   100 IEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLAR--KNMKAPQDGDVVELVRAAG 162
                  :.:|.|:..  |:.|:|.::|:.|.::|:..::|.|.|  |.....::..:|..:|..|
Yeast   114 ------DSNRPAILP--PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLG 170

  Fly   163 GIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIR 227
            .|..:.:..|...|:.:|.:|..|...|..:|..:|.||||||.||.|...:..|:|:||.||||
Yeast   171 AIIFVKTTVPSSMMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIR 235

  Fly   228 LPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFS--EMLQ--IGPITRFARDLPLLLEIMAGDKK 288
            :|:.:.|:||.|||      .|..||...|..|.  |.:.  |||:.|...||...:..:     
Yeast   236 IPSSYQGLFGLKPT------FGRVPYLRVDNSFEGRETIPSVIGPLARDLSDLRYFMSCV----- 289

  Fly   289 HKLKMSEPVALKDMK-VYYAFGYSGFNCLTHPVVDF---DIKLAITKAVTCLERGGVQSKKLDLK 349
              :.:.:| .::|:| :.|.|..|......:.||..   |              |.:.....|::
Yeast   290 --INICQP-WVQDVKCIPYHFDSSTSKLHDNYVVGIWYGD--------------GVIDPPPSDIR 337

  Fly   350 FLRNSLEIALVSLVDL----KGLPSIVTQRADRDPSMRLLMVELFNSIIGHSIFTKEAMVLEVMK 410
                    ||.:..||    ||:.::     ..:||..|.. |||:       ...||.|.:   
Yeast   338 --------ALKTCEDLVNKTKGMKAV-----KWEPSSELSR-ELFD-------LANEADVAD--- 378

  Fly   411 RFNGLMATGN--MEEYRVEAQKIKSHLNQLLGTQG------------------------------ 443
                   :||  ..|:.:..:.:...|..::...|                              
Yeast   379 -------SGNEIKNEFEISGEPLLDILKPMVLENGRPPYTVNEWWDLTKRVYNAQQLMRDYYLSF 436

  Fly   444 -------VLIMPTFHTSALCFHTSLLNVTGIDNLLLFNILGLPATHVPMGT-------------- 487
                   |:|.|   |:.:.|....:..|.:..:||||:|..|:..:|:|:              
Yeast   437 PESERPDVIISP---TTLMPFRPGDMLKTTLRYILLFNVLNFPSLSIPVGSVDCQIDGLMDTTSA 498

  Fly   488 -NQR------------------GMPIGLQVVAAQYQDKLCLKVAAEL 515
             |..                  |.|||||||:..:.|....|.|:.|
Yeast   499 LNPEDKMIKTYWNDLIQSGEIDGFPIGLQVVSPTFNDNEVCKFASWL 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 132/562 (23%)
PRK07488 41..525 CDD:236030 132/562 (23%)
AMD2NP_010528.3 Amidase 79..539 CDD:327489 126/533 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1350
Isobase 1 0.950 0.69812 Normalized mean entropy S4795
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1914
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.