DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and faah

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001103295.1 Gene:faah / 569067 -ID:- Length:590 Species:Danio rerio

Alignment Length:589 Identity:148/590 (25%)
Similarity:249/590 (42%) Gaps:147/590 (25%)


  Fly    20 NKILDFVLPRQK---------PKFSGIRNP------LLKKSVVELVTQLRRGEITSVELVSAYIA 69
            ||||:....|.|         .:|. |:||      ::..|:.||..:|:.|.:....::.|::.
Zfish    45 NKILNARRRRDKSLQQAEQAVQRFK-IQNPGFESSSIVSLSLSELTGKLQDGSLQPDAVLYAFME 108

  Fly    70 RVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGL 134
            :..|||.:||...|...|:.   |:|.|...:|            |..:.|||.::|::.|.||.
Zfish   109 KTLEVNRNLNCGTEMLMESV---AQLKDMNTQK------------KGLLYGVPISIKDNFGYKGH 158

  Fly   135 SFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSA 199
            ..:.|.:::.:..|..|..:|.:::..|.||.:.:..|:..::::..|.|.|:.||||:||:||.
Zfish   159 DSSCGVVSKLDQPAVMDSVIVTVLKKQGAIPFIKTNIPQGLLNYDCGNPIFGQTLNPYNLQKTSG 223

  Fly   200 GSSGGEASLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTG------GL-TSVKGHFPYSLTD 257
            ||||||.:|.|.|.:..|:|:||.||||:|:.|||:.|.|||.      |: |.|||        
Zfish   224 GSSGGEGALIGGGGSILGLGTDIGGSIRIPSAFCGICGFKPTARRLSTRGIDTCVKG-------- 280

  Fly   258 KKFSEMLQIGPITRFARDLPLLLEIMAGDKKHKLKMSEPVALKDMKVYYA-----FGYSGFNCLT 317
             :.|.:..|||:.|....|.|.:..:.......|..:.|....:.:||.:     .||...:...
Zfish   281 -QKSVLSSIGPLARDVESLALCMRALLCQDMFSLDPTIPPLPFNQEVYESSKPLRIGYYETDGYL 344

  Fly   318 HPVVDFDIKLAITKAVTCLERGG---VQSKKLDLKFLRNSLEIALVSLV---------DLKGLPS 370
            .|  ...:..|:.:....|||.|   |..:.|.|..:.:  |:||..::         .||..| 
Zfish   345 QP--SPSMARAVRETKELLERAGHTFVPFQPLRLYNIFH--ELALRGILGDGGETLFSHLKAGP- 404

  Fly   371 IVTQRADRDPSMRLLMVELFNSIIGHSIFTKEAMVLEVMKRF--------NGLMATGNMEEYRVE 427
                   .||.:....|.|     |...|.:: |:..::|.|        :|....|::.|...:
Zfish   405 -------LDPCLCSQPVTL-----GSPRFIRK-MLSFLIKPFFPRISASLHGTCGLGSVAELWRQ 456

  Fly   428 AQKIKSHLNQLLG-----TQGVLIMP------TFH-----TSALCFHTSLLNVTGIDNLLLFNIL 476
            ...::.::.:::.     ...:|:.|      .||     .|||.:.|            |:|:|
Zfish   457 HANVEEYIQEVIAEWRRLDVDILLCPILGPAFNFHYCGRLNSALSYTT------------LYNLL 509

  Fly   477 GLPATHVPMGTNQR-----------------------------GMPIGLQVVAAQYQDKLCLKVA 512
            ..||..|.:.....                             |:|:.:|.|:..:||::||:..
Zfish   510 NFPAGVVCVSAVTEDDEAQLRQYTGAHGDPWDKLFQQAVKGGVGLPVAVQCVSLPWQDEMCLRFM 574

  Fly   513 AELE 516
            .|:|
Zfish   575 REVE 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 138/554 (25%)
PRK07488 41..525 CDD:236030 138/554 (25%)
faahNP_001103295.1 Amidase 101..571 CDD:302749 130/524 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62452214
eggNOG 1 0.900 E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D852596at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127783
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.