DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and CG8839

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_610764.1 Gene:CG8839 / 36340 FlyBaseID:FBgn0033717 Length:529 Species:Drosophila melanogaster

Alignment Length:544 Identity:185/545 (34%)
Similarity:283/545 (52%) Gaps:67/545 (12%)


  Fly    15 FGML---VNKILDFVLPRQKPKFSGIRNPLLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNP 76
            ||:|   :..:...:..::......|.:.:|.:|...|..::|:.|::||:::.::|.|::||||
  Fly    16 FGILQACIRFVFRLIYGQKGESVPPITDAILLESATSLARKIRKQELSSVQVLESFIRRIKEVNP 80

  Fly    77 SLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSL 141
            .||.||::|::.||::|..||..|:  |.::....|..:.|.||||.|.|:...:||:....|..
  Fly    81 ILNCVVDERYDQALKEAAEADALIK--SGQYSTEELEKEKPFLGVPITTKDCISVKGMLHTAGLF 143

  Fly   142 ARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEA 206
            .|::::|.:|.|.:.|:|.||.||:.::...|.||.:|::|.:.||..|.||..|...||||||.
  Fly   144 ERRDVRAARDADAMALMRKAGAIPIALTNVSEVCMWWESNNTVHGRTRNAYDTNRIVGGSSGGEG 208

  Fly   207 SLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHF--PYSLTDKKFSEMLQIGPI 269
            .:....|:.||:||||.||||:||.|.|:|||||:..:.|..|.|  |:|.....|   |.:||:
  Fly   209 CIQSAAASAFGLGSDIGGSIRMPAFFNGIFGHKPSKLVVSNVGQFPAPFSAEQNSF---LGLGPM 270

  Fly   270 TRFARDLPLLLEIMAGDKKHKLKMSEPVALKDMKVYYAFGYSGFNCLTHPVVDFDIKLAITKAVT 334
            :|||.||..:|:||||:|...|.:.|.|.|..||.:|.....|...::  .||.|::.|:.:...
  Fly   271 SRFAEDLRPMLKIMAGEKAALLNLDEDVDLTKMKFFYQESDGGGRLVS--AVDPDLREAMNRVAQ 333

  Fly   335 CLER--GGVQSKKLDLKFLRNSLEIALVSLVDLKGLPSIVTQRADRDPSMRLLMVELFNSIIGHS 397
            .|..  |..:.:::.|...|.|..|...::               ||.|......:|.|  :.|.
  Fly   334 HLREKFGNQKVERIQLPHFRQSAAIWFANM---------------RDDSGHGFAYQLGN--LNHD 381

  Fly   398 IFTKEAMVLEVMKRFNGL-------MATGNMEEYRV------------EAQKIKSHLNQLLGTQG 443
            |.|    .||:.|.|.|.       ::|..|:..:.            :..:::..|..|||..|
  Fly   382 INT----YLELFKWFFGASKHTFIGLSTAIMDSAQCKHGSPKYDHLVRKRNELREELQSLLGDNG 442

  Fly   444 VLIMPTFHTSALCFH----TSLLN--VTGIDNLLLFNILGLPATHVPMG-TNQRGMPIGLQVVAA 501
            |||.|| |.:...:|    |..:|  .|||     .|:||.|||.||:| ....|:|:|:|::|.
  Fly   443 VLIYPT-HPTVAPYHNEPITRPINFAYTGI-----VNVLGFPATAVPLGKLGSEGLPLGVQIIAN 501

  Fly   502 QYQDKLCLKVAAELEAVFHGWVPP 525
            ..||:|||.||.|||..|.||..|
  Fly   502 FNQDRLCLAVAEELERAFGGWAKP 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 181/516 (35%)
PRK07488 41..525 CDD:236030 180/514 (35%)
CG8839NP_610764.1 GatA 42..525 CDD:223232 180/517 (35%)
PRK07488 49..520 CDD:236030 177/505 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62510457
eggNOG 1 0.900 E1_COG0154
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4426
Isobase 1 0.950 0.69812 Normalized mean entropy S4795
OrthoDB 1 1.010 D852596at2759
OrthoFinder 1 1.000 FOG0003208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43372
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.