DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and SPBPB8B6.03

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001018764.1 Gene:SPBPB8B6.03 / 3361182 PomBaseID:SPBPB8B6.03 Length:547 Species:Schizosaccharomyces pombe

Alignment Length:541 Identity:126/541 - (23%)
Similarity:228/541 - (42%) Gaps:93/541 - (17%)


  Fly    23 LDFVLPRQKPKFSGIRNPLLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFE 87
            |:.:||.::       |.:...|::||.|.:.:|..||..:..|:..|....:..||..:|..|:
pombe    46 LNLILPPEE-------NAITNLSMLELATNIAKGNYTSYNVTKAFCHRAALAHQILNCCIEIFFD 103

  Fly    88 AALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDG 152
            .||:.||..|...:|.|....        |..|:|.::|:...|.|...::|.::.......:..
pombe   104 EALKKAKELDDVFQKTSKVVG--------PFHGIPISLKDQVDLPGKDSSIGYVSLVGKPKTEIA 160

  Fly   153 DVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFG 217
            .:.::::..|.|..:.:..|...|:.:|.:|:.|...|..::..:|.||||||.:|.|.||:..|
pombe   161 LLAKILQDKGAIFYVKTTVPMAMMAPQTVSNLHGYTYNALNINLSSGGSSGGEGALLGSGASCCG 225

  Fly   218 VGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFS--EMLQ--IGPITRFARDLPL 278
            :|:||.||||:|:.|.|::..||:.|..|      |......:|  |::.  |||:.|..:|:..
pombe   226 IGTDIGGSIRIPSCFQGLYALKPSTGRIS------YLNVTNSYSGQELIPSVIGPMARSLKDIEF 284

  Fly   279 LLEIMAGDKKHKLKMS-EPVA------LKDMKVYYAFGYSGFNCLTHPVVDFDIKLAITKAVTCL 336
            ..|.:...:..|:... .|:.      ||..|:.:....:......||    .|..|:.:.|..|
pombe   285 FTETVIASEAWKIDSKLLPIPWKNQSHLKSKKLIFGVLKTDGIVKPHP----PIIRALNEVVAVL 345

  Fly   337 ERGGVQSKKLDLKFLRNSLE-IALVSLVDLKGLPSIVTQRADRDPSMRLLMVELFNSIIGHSIFT 400
            |:.|.:..::.:.|.::.|: :..|...|.:...:..:|:.. :|     :|.:....:...||.
pombe   346 EKSGYEVIEISIPFQKDMLDTVVKVFSADARFEINNESQKTG-EP-----VVSVVKRFVSDKIFK 404

  Fly   401 KEAMVLEVMKRFNGLMATGNMEEYRVEAQKIKSHLNQLLGTQG-----VLIMPTFHTSALCFHTS 460
            |...|       |.....|| :.|::....::...|..:.|..     .:|.|.:.:      ||
pombe   405 KPITV-------NEWWDLGN-QVYKIRQMFLELWNNTAIQTLSGNSIDAIIAPIWAS------TS 455

  Fly   461 LLNVTGIDNLL--LFNILGLP-----------------ATHVPMGTNQR------------GMPI 494
            .|..:..|:|.  ||||...|                 .::.|:....:            .||:
pombe   456 FLPESKADHLYTSLFNICDCPCVVFPFTKVDANIDLSDVSYKPLNEEDKENNDMYDPVLFDNMPV 520

  Fly   495 GLQVVAAQYQDKLCLKVAAEL 515
            .||||..:.:::.||..|:.:
pombe   521 CLQVVTKKLEEEKCLAAASSI 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 122/523 (23%)
PRK07488 41..525 CDD:236030 122/523 (23%)
SPBPB8B6.03NP_001018764.1 Amidase 79..535 CDD:302749 112/493 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1322
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133342
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1914
TreeFam 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.