DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and Qrsl1

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001014056.1 Gene:Qrsl1 / 309911 RGDID:1359490 Length:525 Species:Rattus norvegicus

Alignment Length:544 Identity:132/545 (24%)
Similarity:222/545 (41%) Gaps:120/545 (22%)


  Fly    41 LLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASS 105
            :|.:::.|:.:.|::|.||..||....::.:::.. .|||.:....|.||:.|:.:::..::..|
  Rat     1 MLGRTLREVSSALKQGHITPTELCKKCLSLIKKTK-YLNAYITVSEEVALKQAEESEKRYKQGQS 64

  Fly   106 EFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSA 170
            ..|         :.|:|..||::....|:.....|...|....|.:..||:.:...|.:.:..:.
  Rat    65 LGD---------LDGIPVAVKDNFSTSGIETTCASNMLKGYLPPYNATVVQRLLDQGALLMGKTN 120

  Fly   171 NPEFCMSFETSNNIQGRCLNPY------------DLQRTS-----AGSSGGEASLNGCGATTFGV 218
            ..||.|...:::.:.|...||:            |.|..|     .|||||.|:..........:
  Rat   121 LDEFAMGSGSTDGVFGPVKNPWTYSKQYRERSRQDAQEDSHWLITGGSSGGSAAAVAAFTCFAAL 185

  Fly   219 GSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIM 283
            |||..||.|.||..||..|.||:.||.|..|..|.      .:.|...|..||...|..::|.::
  Rat   186 GSDTGGSTRNPAAHCGTVGFKPSYGLVSRHGLIPL------VNSMDVPGIFTRCVDDTAIVLGVL 244

  Fly   284 AG-DKKHKLKMSEPV------ALKDMKVYYAFGYSGFNCL------THPVVDFDIKLAITKAVTC 335
            || |.|....:::||      ::.|:        ||. |:      ..|.:..:|:...::|...
  Rat   245 AGHDPKDSTTVNDPVKPTTLPSVPDV--------SGL-CIGIPKEYLVPELSSEIRSLWSQAADL 300

  Fly   336 LERGGVQSKKLDL-----------------------KFLRNSLEIALVSLVDLKGLPSIVTQRAD 377
            .|..|.:..::.|                       :|  :.|:....|.||:....::..  |.
  Rat   301 FEAEGARVIEVCLPHTCYSIVCYHVLCTSEVASNMARF--DGLQYGHRSAVDMSSTEALYA--AT 361

  Fly   378 RDPSMRLLMVELFNSIIGHSIFTKEAMVLEVMKRFNGLMATGNMEEYRVEAQKIKSHL-NQLLGT 441
            |.        |.||.::...|.:....:|:           .|.|.|.|:|||::..: |..:..
  Rat   362 RQ--------EGFNDVVKGRILSGNFFLLK-----------ENYENYFVKAQKVRRLIVNDFVNV 407

  Fly   442 QG----VLIMPTFHTSALCFHTSLLNVTGIDNLL------LF----NILGLPATHVPMGTNQRGM 492
            .|    ||:.||..|.|:.:    |.....||..      :|    |:.||||.:||:..:.:|:
  Rat   408 FGSGVDVLLTPTTLTQAVPY----LEFIKEDNRTRSAQDDIFTQAVNMAGLPAVNVPVALSSQGL 468

  Fly   493 PIGLQVVAAQYQDKLCLKVAAELE 516
            |||||::...:.|:..|.||...|
  Rat   469 PIGLQLIGRAFCDQQLLTVAKWFE 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 132/545 (24%)
PRK07488 41..525 CDD:236030 132/545 (24%)
Qrsl1NP_001014056.1 PRK07488 5..493 CDD:236030 131/541 (24%)
gatA 13..492 CDD:234572 129/531 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.