DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and SPCC550.07

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_588099.1 Gene:SPCC550.07 / 2539478 PomBaseID:SPCC550.07 Length:533 Species:Schizosaccharomyces pombe

Alignment Length:566 Identity:147/567 (26%)
Similarity:223/567 (39%) Gaps:139/567 (25%)


  Fly    24 DFVLPRQK-PKFSGIRNP----LLKK-SVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVV 82
            |.||...| |...|:..|    |.:| ....|...::..::||||||:|:..|.......:|.|.
pombe    32 DTVLNVTKIPSECGLLTPKEIELTEKYDATALAEMIKDRKVTSVELVTAFCKRAAIAQQLVNCVN 96

  Fly    83 EDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMK 147
            |..:|.||..|...|::..|..|...        |:.|||.:|||...:|..:.....||:.|:.
pombe    97 ELFYEEALARAAELDEYYAKTGSLVG--------PLHGVPVSVKEHISIKNHTATASFLAKANII 153

  Fly   148 APQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCG 212
            |.:|.|:|..||.||.:....:..|:..|..|||:|:.|..:||::.:.|..||||||.:|.|..
pombe   154 AEKDSDLVATVRKAGAVFYCRTPQPQAIMHLETSSNLTGVTVNPFNRKLTPGGSSGGEGALLGIK 218

  Fly   213 ATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLP 277
            |:..|:||||.||||.||...|:||.:|:....|.||  .......:.:.:..:||:.|..||:.
pombe   219 ASVLGIGSDIGGSIRSPAANNGLFGLRPSTLRLSRKG--CQGAVSGQETILGVVGPLGRSVRDMN 281

  Fly   278 LLLEIMAG-----DKKHKLKM-----SEPVALKDMKVYYAFGYSGFNCLTHPVVDFDIKLAITKA 332
            |.::....     |....|.|     :.|   |.:||......:..|  ..|.|...:::||.:.
pombe   282 LFMKACIDSQPWLDDASLLPMPWRSVAPP---KTLKVGIMRSDNVVN--PQPPVARAMQMAIDQL 341

  Fly   333 VTCLERGGVQSKKLDLKFLRNSLEIALVSLVDLKGLPSIVTQRADRDPSMRLL-----------M 386
                      ||..|.            .|||::.|        |...|..|:           .
pombe   342 ----------SKNPDF------------DLVDVEPL--------DHKYSWDLISEMYWLDGGKVY 376

  Fly   387 VELFNSI----------IGHSIFTKEAMVLEVMKRFNGLMATGNMEEYRVEAQKIKSHL-----N 436
            .:|||.:          |.|....|...:..|.|      .|...:|||   .:...||     :
pombe   377 YDLFNKVGEPILPLTEWIMHQPNVKPHDITAVWK------LTAARDEYR---NRYLKHLQAYGVD 432

  Fly   437 QLLGTQGVLIMPTFHTSALCFHTSLLNVTGIDNLLLFNILGLPA-----------------THVP 484
            .||...|....|....:....:||           ::|:|.|||                 :::|
pombe   433 VLLTPVGPSPAPKLGEAKYWTYTS-----------VWNLLDLPAVVFPVTTVDPKLDVKDESYIP 486

  Fly   485 MGTNQRG------------MPIGLQVVAAQYQDKLCLKVAAELEAV 518
            |......            .|:.||:|..::||:   ::.|.|:.:
pombe   487 MNEQDAANYETYSPEDYLDAPVSLQLVGKRWQDE---ELLAALDKI 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 140/545 (26%)
PRK07488 41..525 CDD:236030 140/545 (26%)
SPCC550.07NP_588099.1 Amidase 76..523 CDD:279733 132/515 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1322
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133342
orthoMCL 1 0.900 OOG5_127783
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1914
TreeFam 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.