DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and faah-5

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001317730.1 Gene:faah-5 / 190325 WormBaseID:WBGene00013226 Length:643 Species:Caenorhabditis elegans

Alignment Length:554 Identity:146/555 (26%)
Similarity:235/555 (42%) Gaps:114/555 (21%)


  Fly    40 PLLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKAS 104
            |.|:::       |:..:..:..::|||:.|..::|..:|.:.|...||....|:|.|::.|:  
 Worm    98 PTLREA-------LQSEKFNAYTVLSAYVWRAIKINRKINCITEVIKEAFTDAARLDDEYREQ-- 153

  Fly   105 SEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVS 169
                     .|.|:.|:||:||.:..:.|....||..:....:......:|:.::..|.||..::
 Worm   154 ---------PKPPLFGIPFSVKSNFYVTGYEATVGLASLLEQRETTTCSLVKFLKNQGAIPFCLT 209

  Fly   170 ANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFCG 234
            ..|:..:|:.|||.:.|...||:|..||..|||||||:|...|.|.||:|:|:.||:|:||.|||
 Worm   210 NLPQGLLSYITSNPVYGTTKNPWDFSRTPGGSSGGEAALLAAGGTVFGIGNDLVGSLRIPAAFCG 274

  Fly   235 VFGHKPT----------GGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIMAGDKKH 289
            :...|||          .||.. :|...||           .|..||...|...||.::.|..::
 Worm   275 LVSLKPTQDRLHESEMHPGLPG-RGRLGYS-----------CGFFTRNVEDQEYLLRLVIGKPEY 327

  Fly   290 KLKMSEPVAL-------KDMKVYYAFGY---SGFNCLTHPVVDFDIKLAITKAVTCLERGGVQSK 344
            : :||...:|       .|.|.....|:   .|| |...|    ..:.|:.:.:..|:..|.:.|
 Worm   328 Q-QMSPYSSLSPLLDTSSDDKRKPVIGWFVDDGF-CSVSP----SNQRAVEETIGKLKELGYEVK 386

  Fly   345 K-----LDLKF---------LRNSLEIALVSLVDLKGLPSIVTQRADRDPS-----MRLLMVELF 390
            :     :|.||         .||.:......:.::.|     ::..||..|     :|...|.:.
 Worm   387 EFKVNDIDTKFHSHAVADMLFRNVMPDNGEYMSEMYG-----SEPYDRYMSHFIRLVRYKQVFVI 446

  Fly   391 NSIIGHSIF-------TKEAMVLEVMKRFNGLMATGNMEEYRVEAQKIK-SHLNQLLGTQGVLIM 447
            ..:..|.:.       .|...||.:.|.:|...|.....:.:.::.|:| ....:.||.. .||.
 Worm   447 RWLAQHVLLPLAQYTPLKSKQVLCLGKAYNSDPACVRQNQEKTDSYKMKWIRYWKGLGID-ALIC 510

  Fly   448 PTFHTSALCFHTSLLNVTGIDNLLLFNILGLPATHVPMG-----------TN------------- 488
            |:|.|.|..|...:|..||.....|||:|..|:..||:.           ||             
 Worm   511 PSFITPAQPFKYPVLLTTGAFITGLFNMLDCPSAVVPVAPVREKENDKFETNGDFVLKLQAAAIK 575

  Fly   489 -QRGMPIGLQVVAAQYQDKLCLKVAAELEAVFHG 521
             ..|||..:|:||...|:::||||...:|.:..|
 Worm   576 ETSGMPNSVQIVALPNQEEMCLKVMRIVEEISEG 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 145/554 (26%)
PRK07488 41..525 CDD:236030 145/554 (26%)
faah-5NP_001317730.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62356317
eggNOG 1 0.900 E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D438196at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1914
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.