DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and faah-1

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_501368.1 Gene:faah-1 / 177613 WormBaseID:WBGene00015047 Length:572 Species:Caenorhabditis elegans

Alignment Length:636 Identity:152/636 - (23%)
Similarity:245/636 - (38%) Gaps:182/636 - (28%)


  Fly     3 IILRLLAFILNAFGMLVN---------KILDFVLPRQKPKFSGIRN-PLLKKSVVELVTQ----- 52
            :|..|:..:|.|....|:         :.|:.|..|::...|  :| ...:|:..:|.||     
 Worm     1 MIFYLVLLVLGAIAFYVHFSNNRKKLIERLEIVAQRRRDDLS--KNVEQARKAADKLDTQRRDWI 63

  Fly    53 -----------LRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSE 106
                       |:||.:|.||.:.||..:....:...|||.     ..:.||       |:.:.|
 Worm    64 GSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVT-----CFILDA-------ERQAEE 116

  Fly   107 FD---RVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLV 168
            .|   ::..|.|.|:.|||.::||...:||.....|.:......|.:|...||..:..|.||...
 Worm   117 LDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQ 181

  Fly   169 SANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFC 233
            :..|:..:|:..||.:.|...||||..||..||||||.:|.|.|.:..|:|:|:.||:|:|..|.
 Worm   182 TNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFT 246

  Fly   234 GVFGHKPT-------GGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIMA---GD-- 286
            |..|.||:       ||..||.|.......|         ||:   |:|:...:|.:.   ||  
 Worm   247 GTAGIKPSKMRFAHRGGGASVPGKPLIDAND---------GPM---AKDVKTNVEFLRNVWGDID 299

  Fly   287 --------------------KKHKLKMS--------------EPVALKDMKVYYAFGYSGFNCLT 317
                                .:.||::.              :...|:..|...|.|        
 Worm   300 FQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTPTPALQRAVLESKKHLEAAG-------- 356

  Fly   318 HPVVDF------DIKLAITKAVTCLERGGVQSKKLDLKFLRNSLEIALVSLVDLKGLPSIVTQRA 376
            |.|:.|      .:.....:|| ||:.|.....||    |::.:|            |:|..|  
 Worm   357 HTVIPFYPPRLPSVMQLYFRAV-CLDGGQYVLNKL----LKDIIE------------PTIRFQ-- 402

  Fly   377 DRDPSMRLLMVELF-NSIIGHS---IFTKEAMVLEVMKR--FNGLMATGNMEEYRVE--AQKIKS 433
                 :.|.||.:: ..|:.:.   :|.:..|:::.:.|  |....|..::|.||.|  ...:|.
 Worm   403 -----VTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLTRDTFELREAYADIEAYREEFVGLMMKD 462

  Fly   434 HLNQLLGTQGVLIMPTFHTSALCFHTSLLNVTGIDNLLLFNILG-----LPATHVPMGTNQR--- 490
            :|:.:|....::..|.....:..       |:|:....|:|:|.     :|.|.|.....::   
 Worm   463 NLDVILCPASIMPAPQHDIPSKV-------VSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLIN 520

  Fly   491 --------------------GMPIGLQVVAAQYQDKLCLKVAAELEAVFHG 521
                                |||||:||.|..|:::..|:...|:|....|
 Worm   521 EYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREIEIAVTG 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 142/588 (24%)
PRK07488 41..525 CDD:236030 142/588 (24%)
faah-1NP_501368.1 Amidase 84..559 CDD:279733 129/537 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62441901
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D438196at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127783
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1914
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.