DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and faah-4

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_499545.1 Gene:faah-4 / 176620 WormBaseID:WBGene00013232 Length:647 Species:Caenorhabditis elegans

Alignment Length:576 Identity:148/577 (26%)
Similarity:238/577 (41%) Gaps:147/577 (25%)


  Fly    39 NPLLKKSVVELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKA 103
            |.:||..::.|.:.|:..:..:..::.|::.|..:||..:|.:.|...||......|.|.:.:..
 Worm    88 NEILKLDLIALKSALQTDKYNAYTVLCAFVWRAIDVNSEINCITEVIREAFNTAEALDDNYAQTG 152

  Fly   104 SSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLAR-----KNMKAPQDGDVVELVRAAGG 163
            .          |..:.|:||:||.:..::.....|| ||:     |....|    :|:.:...|.
 Worm   153 E----------KGQLFGLPFSVKSNFYMENYDVTVG-LAKLLEQPKTTTCP----MVQFLSDQGA 202

  Fly   164 IPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRL 228
            :|..::..|:..:|:.:||.|.|...||:|..||..|||||||:|...|...||:|||::||:|:
 Worm   203 VPFCLTNVPQGLLSYVSSNPIYGTTKNPWDFSRTPGGSSGGEAALLAAGGAAFGIGSDLAGSLRI 267

  Fly   229 PALFCGVFGHKPT----------GGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIM 283
            ||.|||:...|||          |||.. :|...           |..|..||..::...||.::
 Worm   268 PAAFCGLVTLKPTQDRLCVTDTHGGLPG-RGRLG-----------LSFGFYTRSVKEQEFLLGLI 320

  Fly   284 AGDKKH--KLKMSEPVAL-----KDMKVYYA-FGYSGFNCLTHPVVDFDIKLAITKAVTCLERGG 340
            .|..::  ...||.|..|     ||.|:... |...|||    |||..: :.|:.:.|..|:..|
 Worm   321 VGRSEYLELCPMSSPAKLEKHIEKDQKLVIGWFVDDGFN----PVVPSN-RRAVEETVKSLQAKG 380

  Fly   341 VQSKKLDLKFLRNSLEIALVSLVDL---KGLPS--------IVTQRADRDPSMRLLMVELFNSII 394
            .|  .::||....|.|....::.|:   ..:|.        ...::.|....:.:.:|.|..:.:
 Worm   381 HQ--VVELKLADVSEEFPPFAVADMLFRNVMPDNGAYMSEMYAGEQYDEHMKLFIRLVCLKQNFL 443

  Fly   395 -------GHSIFTKEAMVLEVMKR-------FNGLMAT-----GNMEEYRVE------AQKIKSH 434
                   |...|.|    |.:.||       :|..:|.     .|.:.|:::      ::||.: 
 Worm   444 VSFLLRYGVMPFAK----LALSKRLACIGSAYNSDLAACRQNQENTDSYKLQWIRYWKSKKIDA- 503

  Fly   435 LNQLLGTQGVLIMPTFHTSALCFH--TSLLN---VTGIDNLLLFNILGLPATHVPMG-TNQR--- 490
                      ||.|:|.|.|..|.  ..|.|   :||     |||:|.:||..||:. .||:   
 Worm   504 ----------LICPSFITPAQPFEYPAQLSNGAFITG-----LFNMLDVPAGVVPVSPVNQKDVD 553

  Fly   491 -------------------------GMPIGLQVVAAQYQDKLCLKVAAELEAVFHG 521
                                     |:|..:|||.....:::||:|...:|....|
 Worm   554 QLIDGFSTEGDLLLKKQREAARGTTGLPNAVQVVTLPNCEEMCLRVMRLVEESAEG 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 147/575 (26%)
PRK07488 41..525 CDD:236030 147/575 (26%)
faah-4NP_499545.1 Amidase 112..597 CDD:302749 139/539 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62356253
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D438196at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.