DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and FAAH2

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_777572.2 Gene:FAAH2 / 158584 HGNCID:26440 Length:532 Species:Homo sapiens

Alignment Length:547 Identity:194/548 (35%)
Similarity:290/548 (53%) Gaps:52/548 (9%)


  Fly     6 RLLAFILNAFGMLVNKILDFVLPRQKPKFSG-----IRNPLLKKSVVELVTQLRRGEITSVELVS 65
            |:..|:|.|.|.|:..:....|....|||:.     :..|||..|.::|...:|:.::..:::|.
Human     8 RIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDVVQ 72

  Fly    66 AYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCG 130
            |||.|:::|||.:|.:|:.|||.|:::|...||  :.|..:.|...|..|:|.||||.||||:..
Human    73 AYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQ--KLAEKQEDEATLENKWPFLGVPLTVKEAFQ 135

  Fly   131 LKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQ 195
            |:|:..:.|.:.|::..|..|..||.|::.||.|||.::...|.||.:|:||.|.||..||||||
Human   136 LQGMPNSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQ 200

  Fly   196 RTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKF 260
            ....||||||........:..||||||.||||:||.|.|:|||||:.|:...||.||.::..::.
Human   201 HIVGGSSGGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQEL 265

  Fly   261 SEMLQIGPITRFARDLPLLLEIMAGDKKHKLKMSEPVALKDMKVYYAFGYSGFNCLTHPVVDFDI 325
              .|..||:.|:|.||..:|::|||....:||:...|.|||:|.|: ..:.|.:.|... ||.|:
Human   266 --FLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKVHLKDLKFYW-MEHDGGSFLMSK-VDQDL 326

  Fly   326 KLAITKAVTCLER-GGVQSKKLDLKFLRNSLE--IALVS-----------LVDLKGLPSIVTQRA 376
            .:...|.|..||. .|...:.:.||.::.|.:  ||::|           .|||.|         
Human   327 IMTQKKVVVHLETILGASVQHVKLKKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLG--------- 382

  Fly   377 DRDPSMRLLMVELFNSIIGHSIFTKEAM---VLEVMKRFNGLMATGNMEEYRVEAQKIKSHLNQL 438
            |....:..|. ||....:|.|::|..::   :||...|:    :....::::...:.::..|..:
Human   383 DHGKHVSPLW-ELIKWCLGLSVYTIPSIGLALLEEKLRY----SNEKYQKFKAVEESLRKELVDM 442

  Fly   439 LGTQGVLIMPTFHTSALCFHTSLLN-----VTGIDNLLLFNILGLPATHVPMGTNQRGMPIGLQV 498
            ||..||.:.|:..|.|...|..|..     .||:     |:.||||.|..|:|.|.:|:|:|:||
Human   443 LGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGV-----FSALGLPVTQCPLGLNAKGLPLGIQV 502

  Fly   499 VAAQYQDKLCLKVAAELEAVFHGWVPP 525
            ||..:.|.|.|.||..||..|.|||.|
Human   503 VAGPFNDHLTLAVAQYLEKTFGGWVCP 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 183/508 (36%)
PRK07488 41..525 CDD:236030 182/506 (36%)
FAAH2NP_777572.2 GatA 48..526 CDD:223232 180/503 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0154
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.69812 Normalized mean entropy S4795
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D852596at2759
OrthoFinder 1 1.000 FOG0003208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43372
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.