DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7910 and faah2

DIOPT Version :8

Sequence 1:NP_001287222.1 Gene:CG7910 / 40956 FlyBaseID:FBgn0037547 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_002940451.1 Gene:faah2 / 100488850 XenbaseID:XB-GENE-6036595 Length:527 Species:Xenopus tropicalis

Alignment Length:545 Identity:185/546 (34%)
Similarity:287/546 (53%) Gaps:45/546 (8%)


  Fly     1 MEIILRLLAFILNAFGMLVNKILDF-----VLPRQKPKFSGIRNPLLKKSVVELVTQLRRGEITS 60
            |.::.|||...|.....   .:|.|     |..|..|......:|||.....:|..::||.|:.|
 Frog     1 MRLLHRLLVCTLRGLSW---ALLGFIRLLSVFSRDPPCPDPPLDPLLFIPATKLADKIRRRELQS 62

  Fly    61 VELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTV 125
            ..:|.|:|:|:::|||:|||||.:||:.|||:|:..|:.:  :|...:...|..|||:|||||||
 Frog    63 SAVVQAFISRIRQVNPALNAVVCERFDQALQEARNVDELV--SSGTENEETLREKYPLLGVPFTV 125

  Fly   126 KESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLN 190
            ||:..|:|:..:.|.|:|:.:.:..|..||..:::||||||.|:...|.||.:|:||.:.|:..|
 Frog   126 KEAFALQGMPQSSGLLSRRFVCSQSDAVVVSRIKSAGGIPLGVTNCSELCMWYESSNKVYGKTRN 190

  Fly   191 PYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSL 255
            ||:.|....||||||..:.....:..||||||.||||:||.|.|::|||.|..:....|.||  :
 Frog   191 PYNPQHIVGGSSGGEGCILATAGSVIGVGSDIGGSIRMPAFFNGIYGHKATADIVPNDGQFP--I 253

  Fly   256 TDKKFSEMLQIGPITRFARDLPLLLEIMAGDKKHKLKMSEPVALKDMKVYYAFGYSGFNCLTHPV 320
            .|....|.|..||:.|:|.||..||::|||:...:|.:...|.|..:: :::..:.|.:.:. ..
 Frog   254 DDGCRREFLCTGPMCRYAGDLIPLLKVMAGESAGRLHLDREVKLSSLR-FFSMEHDGGSPIV-SA 316

  Fly   321 VDFDIKLAITKAVTCLERG-GVQSKKLDLKFLRNSLEIALVSLVDLKGLPSIVTQRADRDPSMRL 384
            ||.::..|..:.|..|||. ||..:::.:..||.|..|          ..::::|....:.|...
 Frog   317 VDKELVQAQRRVVEHLERELGVTVQQVSIYNLRYSFPI----------WSAMMSQDGGEEQSFAD 371

  Fly   385 LM---------VELFNSIIGHSIFTKEAMVLEVMKRFNGLMATGNMEEYRVEAQKIKSHLNQLLG 440
            ||         .||...:.|.|..|...:.|.:.::.......|| |....:|:.::..::.:||
 Frog   372 LMGDGKGFWPFWELLKWMFGISKHTLPGIALALTEKMAHWNTQGN-ENMIKKARSLRQEISTMLG 435

  Fly   441 TQGVLIMPTFHTSALCFHTSL-----LNVTGIDNLLLFNILGLPATHVPMGTNQRGMPIGLQVVA 500
            ..|:||.|:....|...|..:     ...|||     ||:|.||.|..|:|.::.|:|:|:|:||
 Frog   436 DDGILIYPSHPKIAPRHHEPIAMPFNFAYTGI-----FNVLALPVTQCPVGLSRDGLPLGIQLVA 495

  Fly   501 AQYQDKLCLKVAAELEAVFHGWVPP 525
            :.|.|:|.|.:|..||....||:||
 Frog   496 SHYNDRLTLALAQYLEKTMVGWIPP 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7910NP_001287222.1 GatA 41..527 CDD:223232 174/501 (35%)
PRK07488 41..525 CDD:236030 173/499 (35%)
faah2XP_002940451.1 PRK07488 48..520 CDD:236030 171/494 (35%)
Amidase 64..504 CDD:302749 159/462 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D852596at2759
OrthoFinder 1 1.000 FOG0003208
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.