| Sequence 1: | NP_649757.1 | Gene: | CG2767 / 40946 | FlyBaseID: | FBgn0037537 | Length: | 329 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011972.1 | Gene: | GRE3 / 856504 | SGDID: | S000001146 | Length: | 327 | Species: | Saccharomyces cerevisiae | 
| Alignment Length: | 327 | Identity: | 118/327 - (36%) | 
|---|---|---|---|
| Similarity: | 181/327 - (55%) | Gaps: | 36/327 - (11%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68 
  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKL----- 128 
  Fly   129 ------------DKEGLMEVDVTTNHAAI---WVAMEALVEKGLTKSIGVSNFSKDQVARLLKNC 178 
  Fly   179 KIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVK 243 
  Fly   244 EIAASH-GKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDV-FDFELTAEEVAKLSSLDQNIRI 306 
  Fly   307 CD 308 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2767 | NP_649757.1 | ARA1 | 5..302 | CDD:223729 | 114/318 (36%) | 
| Tas | 10..297 | CDD:223739 | 111/308 (36%) | ||
| GRE3 | NP_011972.1 | AKR_SF | 3..318 | CDD:412396 | 118/326 (36%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53635 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000042 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100072 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X51 | |
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.820 | |||||