DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and GRE3

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_011972.1 Gene:GRE3 SGDID:S000001146 Length:327 Species:Saccharomyces cerevisiae

Alignment Length:327 Identity:118/328 (36%)
Similarity:181/328 (55%) Gaps:36/328 (11%)


  Fly     4 TKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..:|.|||.|||::|:|.|:...:.....|..|::.|||..|.|..|||||.:|..:::.:..|
Yeast     2 SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEG 66

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKL----- 128
            .|.|:::|:|:|:....:.|..|:..:||:|.|:.|||:|||.:|.|.        :||.     
Yeast    67 LVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPI--------AFKYVPFEE 123

  Fly   129 ------------DKEGLMEVDVTTNHAAI---WVAMEALVEKGLTKSIGVSNFSKDQVARLLKNC 178
                        :|:|    .:|..|..|   :.|:|..|::||.||||||||....:..||:.|
Yeast   124 KYPPGFYTGADDEKKG----HITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLRGC 184

  Fly   179 KIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVK 243
            :|:|...|||||.||.|..||:|||..:|.|.|||..|.:...:.:  ..:.:..|.|.:...:|
Yeast   185 RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMD--LQLAKTTPTLFENDVIK 247

  Fly   244 EIAASH-GKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDV-FDFELTAEEVAKLSSLDQNIRI 306
            :::.:| |.|.:||||||....|::.||||:...||..||:: ..|.||.:|:..:|:|:.|||.
Yeast   248 KVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKDISALNANIRF 312

  Fly   307 CD 308
            .|
Yeast   313 ND 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 114/319 (36%)
Tas 10..297 CDD:223739 111/309 (36%)
GRE3NP_011972.1 ARA1 1..326 CDD:223729 118/328 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.