DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and GCY1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_014763.1 Gene:GCY1 SGDID:S000005646 Length:312 Species:Saccharomyces cerevisiae

Alignment Length:330 Identity:126/331 (38%)
Similarity:185/331 (56%) Gaps:41/331 (12%)


  Fly     3 NTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            :||.|:.|.|.::|.||:||||:.:.:...|:..||:.||||||||.:|.||..:|:.:|   |:
Yeast     8 STKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIK---DS 69

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTIN----INED-GSFK 127
            | |.|||:|:.||:  ...:.||.|..:.:||:.|.||||||||:|.|..::    .||| .|..
Yeast    70 G-VPREEIFVTTKL--WCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVP 131

  Fly   128 LDKEGLMEVDVTT-NHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLL--KNCKIRPANNQIEH 189
            ..|:|...||:|. |....|..|:.|.:.|.||::||||||.:.:..||  :..|:.||.||:|.
Yeast   132 TKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEI 196

  Fly   190 HVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPA 254
            |..|.|.:|::||||:.|.|.|||||||             .|.| |:..|.:.|||..:...|.
Yeast   197 HPLLPQDELINFCKSKGIVVEAYSPLGS-------------TDAP-LLKEPVILEIAKKNNVQPG 247

  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER-- 317
            .|::.|.:..|...:|||.||.|:|.|..:  |.|:.|:...::::.:.         .|.:|  
Yeast   248 HVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAINNISKE---------KGEKRVV 301

  Fly   318 HPEFT 322
            ||.::
Yeast   302 HPNWS 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 121/305 (40%)
Tas 10..297 CDD:223739 119/295 (40%)
GCY1NP_014763.1 ARA1 14..308 CDD:223729 123/325 (38%)
Tas 15..294 CDD:223739 119/301 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.