DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and YJR096W

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae

Alignment Length:302 Identity:105/303 (35%)
Similarity:158/303 (52%) Gaps:41/303 (14%)


  Fly     5 KFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWL--DA 67
            ||...:||.|:|.|.:||:.....:....:...::.||||.|||.:|||||.:|..:.:||  |.
Yeast     4 KFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDP 68

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQ-LDYVDLYLVHTPFTININEDGSFKLDKE 131
            |..||||:|..||:....|.....:..|::.|.::. |.|:||.|:|:|.      :|| ||..|
Yeast    69 GNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL------EGS-KLRLE 126

  Fly   132 GLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQ 194
                         .|.||:..|::||.|||||||:.|..:..||.  ..|.:|..||||...::.
Yeast   127 -------------TWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIM 178

  Fly   195 QRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLR 259
            :::|.|:|||:.:.|.|::|| ..|....|         |||:.:  .||:    .:.|.|||:|
Yeast   179 RQELADYCKSKGLVVEAFAPL-CHGYKMTN---------PDLLKV--CKEV----DRNPGQVLIR 227

  Fly   260 WIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLD 301
            |.:..|...:||:....||:.||..::|||:.|::..|...|
Yeast   228 WSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDHPD 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 105/303 (35%)
Tas 10..297 CDD:223739 101/292 (35%)
YJR096WNP_012630.1 ARA1 1..277 CDD:223729 105/303 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.