DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and YDL124W

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_010159.1 Gene:YDL124W SGDID:S000002282 Length:312 Species:Saccharomyces cerevisiae

Alignment Length:335 Identity:105/336 (31%)
Similarity:160/336 (48%) Gaps:67/336 (20%)


  Fly     5 KFLTFNNGEKMP---VIGIGT-WQASDEE--------IETAIDAALEAGYRHIDTAPVYGNEKAI 57
            :|.|.|||.|:|   :||.|| |..::|.        :|..:.|....|..|||.|.:|.....:
Yeast     6 QFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPEV 70

  Fly    58 GRVLKRWLDAGKVKREELFIVTKVPP---VSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTIN 119
            |:.    |...:..|..:|:..|..|   :|:.|.:   .:..:|:.:..|||||||:|:||.  
Yeast    71 GKA----LSLTEKPRNAIFLTDKYSPQIKMSDSPAD---GLDLALKKMGTDYVDLYLLHSPFV-- 126

  Fly   120 INEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPAN 184
            ..|.....|::              .|..||.|.:.|..|:||||||:.:.:.|:||..:::|..
Yeast   127 SKEVNGLSLEE--------------AWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVKPQV 177

  Fly   185 NQIEHHVYLQQR--DLVDFCKSENITVTAYSPLG--SKGIAKFNAGAGIVRDLPDLMDIPE-VKE 244
            ||||...:||.:  .:..||:..:|.|.||||||  .|..|:           .|.....| |||
Yeast   178 NQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQ-----------DDSQPFFEYVKE 231

  Fly   245 IAASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDF 309
            ::..:.|:.||::|||:...||..:..|:.|.|:....::|.|:||||||.|::.|         
Yeast   232 LSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITEL--------- 287

  Fly   310 AFFHGVERHP 319
                |:|..|
Yeast   288 ----GLEHEP 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 102/317 (32%)
Tas 10..297 CDD:223739 99/307 (32%)
YDL124WNP_010159.1 ARA1 4..299 CDD:223729 105/336 (31%)
Tas 11..291 CDD:223739 102/327 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.