DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and AT1G59960

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_176204.1 Gene:AT1G59960 AraportID:AT1G59960 Length:326 Species:Arabidopsis thaliana

Alignment Length:307 Identity:119/308 (39%)
Similarity:170/308 (55%) Gaps:29/308 (9%)


  Fly    15 MPVIGIGTWQASDEE----IETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK-REE 74
            |||:|.||..:...|    .||.|: |::.||||.||:|.|..|:.||..|...:..|.|: |.|
plant    21 MPVLGFGTAASPLPEPTMLKETVIE-AIKLGYRHFDTSPRYQTEEPIGEALAEAVSLGLVRSRSE 84

  Fly    75 LFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFK--LDKEGLMEVD 137
            .|:.||:.........|.|.||:||::|:|||:|||::|.|.:   ::.|.:|  :|::..|.:|
plant    85 FFVTTKLWCADAHGGLVVPAIKRSLKNLKLDYLDLYIIHWPVS---SKPGKYKFPIDEDDFMPMD 146

  Fly   138 VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVDFC 202
                ...:|..||.....||.|.|||||||..::..:|....|.|:.||:|.....|||.|.:.|
plant   147 ----FEVVWSEMEECQRLGLAKCIGVSNFSCKKLQHILSIATIPPSVNQVEMSPIWQQRKLRELC 207

  Fly   203 KSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVS 267
            :|.:|.|||||.|||:|     |..|    .|.:|:...:||||.:..||.|||.:||..:.|||
plant   208 RSNDIVVTAYSVLGSRG-----AFWG----TPKIMESDVLKEIAEAKEKTVAQVSMRWAYEQGVS 263

  Fly   268 AIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHG 314
            .:.||....||::||.:||:.||.:|..::|:     .|..|...||
plant   264 MVVKSFTKERLEENLKIFDWSLTEDETQRIST-----EIPQFRNVHG 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 115/294 (39%)
Tas 10..297 CDD:223739 114/289 (39%)
AT1G59960NP_176204.1 ARA1 19..295 CDD:223729 115/291 (40%)
Tas 22..293 CDD:223739 113/288 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1016440at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.