DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and ChlAKR

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001031505.1 Gene:ChlAKR AraportID:AT2G37770 Length:315 Species:Arabidopsis thaliana

Alignment Length:297 Identity:127/298 (43%)
Similarity:183/298 (61%) Gaps:16/298 (5%)


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |...|.|.|.|.:|:||||||...:..|:.||::.||||||.|.:|||||.||.|||:..:...|
plant     7 FFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVV 71

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
            |||:|||.:|:....:.|.:|...:.::|:||||:||||||:|.|..|   :.||..:..|.|:.
plant    72 KREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARI---KKGSVGIKPENLLP 133

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLVD 200
            ||:.:.    |.|||||.:.|..::|||||||..::|.||:..::.||.||:|.|...:|..|.:
plant   134 VDIPST----WKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQE 194

  Fly   201 FCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTG 265
            ||||:.:.::|||||||.|.....:         |::..|.:..:|...||:||||.|||.:..|
plant   195 FCKSKGVHLSAYSPLGSPGTTWLKS---------DVLKNPILNMVAEKLGKSPAQVALRWGLQMG 250

  Fly   266 VSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQ 302
            .|.:|||||..|:|:|.:|||:.:.....||.:.::|
plant   251 HSVLPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIEQ 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 126/296 (43%)
Tas 10..297 CDD:223739 125/287 (44%)
ChlAKRNP_001031505.1 Tas 5..285 CDD:223739 126/294 (43%)
ARA1 6..285 CDD:223729 126/294 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1016440at2759
OrthoInspector 1 1.000 T124719
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.