DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and AKR4C8

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_565871.1 Gene:AKR4C8 AraportID:AT2G37760 Length:311 Species:Arabidopsis thaliana

Alignment Length:326 Identity:136/327 (42%)
Similarity:193/327 (59%) Gaps:41/327 (13%)


  Fly     5 KFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGK 69
            :|...|.|.|:|.:|:||:..    :.|||:.|::.||||||.|.:|||||.||.|||:.:..|.
plant     6 RFFELNTGAKLPCVGLGTYAM----VATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGF 66

  Fly    70 VKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLM 134
            ||||||||.:|:....:.|.:|...::|:|:|||:|||||||:|.|.:          |.||.||
plant    67 VKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPAS----------LKKESLM 121

  Fly   135 -------EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY 192
                   :.|:|:.    |.|||||.:.|..::|||||||..::..||...::.||.||:|.|..
plant   122 PTPEMLTKPDITST----WKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPV 182

  Fly   193 LQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVL 257
            .||:.|.:.|||:.:.::.||||||:       ..|.||  ..::..|.|.|:|...|||.|||.
plant   183 WQQQGLHELCKSKGVHLSGYSPLGSQ-------SKGEVR--LKVLQNPIVTEVAEKLGKTTAQVA 238

  Fly   258 LRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQN--IRICDFA-----FFHGV 315
            |||.:.||.|.:|||::.||||:||||||:.:..:...|.|::.|.  .|..:||     |:..:
plant   239 LRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQEKFCRATEFAHETHGFYKTI 303

  Fly   316 E 316
            |
plant   304 E 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 130/304 (43%)
Tas 10..297 CDD:223739 128/294 (44%)
AKR4C8NP_565871.1 ARA1 7..273 CDD:223729 128/293 (44%)
Tas 11..277 CDD:223739 127/293 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1016440at2759
OrthoInspector 1 1.000 T124719
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.