DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and AT2G21260

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_179722.1 Gene:AT2G21260 AraportID:AT2G21260 Length:309 Species:Arabidopsis thaliana

Alignment Length:313 Identity:129/314 (41%)
Similarity:181/314 (58%) Gaps:12/314 (4%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71
            :|.|:|.|||:||:|.|:...||:...|..|::.||||:|.|..|.||..:|..|......|.||
plant     3 ITLNSGFKMPIIGLGVWRMEKEELRDLIIDAIKIGYRHLDCAANYKNEAEVGEALTEAFTTGLVK 67

  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGS--FKLDKEGLM 134
            ||:|||.||:.. |:..|.:| ..|.||:.|||||:||:|||.|........|:  ..|..:|::
plant    68 REDLFITTKLWS-SDHGHVIE-ACKDSLKKLQLDYLDLFLVHIPIATKHTGIGTTDSALGDDGVL 130

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199
            ::|.|.:....|..||.||..||.:|||:||:........|...||:||.||||.|.|.|:..||
plant   131 DIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAVNQIETHPYFQRDSLV 195

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNA-GAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIID 263
            .||:...|.|||::|||.   |..|| ..|.|..|.|    |.:|::|..:.:|.||::|||.|.
plant   196 KFCQKHGICVTAHTPLGG---ATANAEWFGTVSCLDD----PVLKDVAEKYKQTVAQIVLRWGIQ 253

  Fly   264 TGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVE 316
            .....|||::.|.||::|..||||:|:.|::..:.|:::|.|....|.|.|:|
plant   254 RNTVVIPKTSKPERLEENFQVFDFQLSKEDMEVIKSMERNYRTHQTAKFWGIE 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 123/298 (41%)
Tas 10..297 CDD:223739 121/290 (42%)
AT2G21260NP_179722.1 ARA1 1..296 CDD:223729 125/302 (41%)
Tas 6..287 CDD:223739 121/290 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1016440at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.