DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and akr1c2

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001072204.1 Gene:akr1c2 XenbaseID:XB-GENE-5844204 Length:324 Species:Xenopus tropicalis

Alignment Length:331 Identity:128/332 (39%)
Similarity:193/332 (58%) Gaps:23/332 (7%)


  Fly     6 FLTFNNGEKMPVIGIGTW-------QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKR 63
            ::..|:|.:|||||.||:       ..::|..:.|||    .||||||:|..|.||..:||.:..
 Frog     8 YVLLNDGNRMPVIGYGTYAPQNVPKHLAEEGAKVAID----VGYRHIDSAFTYLNEAEVGRAINA 68

  Fly    64 WLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKL 128
            .:..|.||||:||...|:....:.|..|....:|||:||||||:||:::|.|.... .||..|.:
 Frog    69 KIADGTVKREDLFYTGKLWSSFHTPERVRQGFEKSLKDLQLDYMDLFIIHLPVEFK-PEDNPFPV 132

  Fly   129 DKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHV 191
            |:.|.. :...|:....|.|||||.::||.||||||||:|.|:..:|.  ..|.:|..||:|.|:
 Frog   133 DENGKF-LYHNTDLRDTWKAMEALKDEGLVKSIGVSNFNKRQLELILSMPGLKYKPVCNQVECHI 196

  Fly   192 YLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQV 256
            ||.|..|::||||::|.:..||.|||....::     |.::.|.:::.|.:..||....:|||||
 Frog   197 YLNQSKLLEFCKSKDIVLVGYSVLGSSRDEQW-----IDQNSPVVLEDPVLNAIAKKLNRTPAQV 256

  Fly   257 LLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEF 321
            .:|:::..||..:.||..|||::||..:|||:|.|||:..|..:::|:|..|   ...:..||::
 Frog   257 AMRYLLQRGVVILAKSFTPARIQQNFQIFDFQLNAEEMKTLDGVNKNLRYLD---LKQLADHPKY 318

  Fly   322 TFKNQY 327
            .|.:.|
 Frog   319 PFADDY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 121/305 (40%)
Tas 10..297 CDD:223739 120/296 (41%)
akr1c2NP_001072204.1 ARA1 8..306 CDD:223729 123/309 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.