DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and Akr1c21

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 MGIID:1924587 Length:323 Species:Mus musculus

Alignment Length:333 Identity:117/334 (35%)
Similarity:191/334 (57%) Gaps:17/334 (5%)


  Fly     2 VNTK--FLTFNNGEKMPVIGIGT---WQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVL 61
            :|:|  .:..|:|..:||:|.||   .:....:.:.....|::||:.|.|:|.||..|..:|..:
Mouse     1 MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAI 65

  Fly    62 KRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF 126
            :..:..|.|:||::|..:||...|..|..|..::::||:.||.|||||||:|.|..:...|: :|
Mouse    66 RSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEE-NF 129

  Fly   127 KLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEH 189
            .:|:.|.:..| ..:..|.|.|||...:.|||||||||||:..|:..:|.  ..|.:|..||:|.
Mouse   130 PVDEHGKLIFD-RVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVEC 193

  Fly   190 HVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPA 254
            |.||.|..|:|||||::|.:.||..||::     ..|..:.::.|.|:|.|.:..:|..:.:|||
Mouse   194 HPYLNQMKLLDFCKSKDIVLVAYGVLGTQ-----RYGGWVDQNSPVLLDEPVLGSMAKKYNRTPA 253

  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHP 319
            .:.||:.:..|:..:..|....|:|:|:.||:|:|::|::..|..|::|:|....|.|.|   ||
Mouse   254 LIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKG---HP 315

  Fly   320 EFTFKNQY 327
            .:.|.::|
Mouse   316 NWPFLDEY 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 107/304 (35%)
Tas 10..297 CDD:223739 104/292 (36%)
Akr1c21NP_084177.2 ARA1 8..307 CDD:223729 108/306 (35%)
Tas 11..297 CDD:223739 105/293 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.