DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2767 and AKR1D1

Sequence 1:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_005980.1 Gene:AKR1D1 HGNCID:388 Length:326 Species:Homo sapiens

Alignment Length:335 Identity:117/336 (35%)
Similarity:185/336 (55%) Gaps:32/336 (10%)


  Fly     7 LTFNNGEKMPVIGIGTWQASDE----EIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            :..::|..:|:||:||:.....    ...|::..|::.||||||.|.:|.||..:|..::..:..
Human    10 IPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAE 74

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTIN-------INEDGS 125
            |||:||::|...|:...::.|..|.||::::|..|||||||||::..|....       .:|:|.
Human    75 GKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGK 139

  Fly   126 FKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIE 188
            :...|         :|..|.|.||||..:.||.||:|||||::.|:..:|.  ..|.:|.:||:|
Human   140 WLYHK---------SNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVE 195

  Fly   189 HHVYLQQRDLVDFCKSENITVTAYSPLG-SKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKT 252
            .|.|..|..|:.||:..:|.:||||||| |:.....|..:      |.|:....:..:...:.||
Human   196 CHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSS------PPLLKDALLNSLGKRYNKT 254

  Fly   253 PAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER 317
            .||::||:.|..||..||||.|..|:|:|..:|||.||.||:..:.:|::|:|..:...:..   
Human   255 AAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRD--- 316

  Fly   318 HPEFTFKNQY 327
            |||:.|.::|
Human   317 HPEYPFHDEY 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 110/309 (36%)
Tas 10..297 CDD:223739 109/301 (36%)
AKR1D1NP_005980.1 ARA1 9..309 CDD:223729 112/314 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.